NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS57986.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
57986.1 Public Homo sapiens 1 P3H1 22 109 92 CCDS HistoryNCBI Gene:64175Re-query CCDS DB by CCDS ID:57986.1Re-query CCDS DB by GeneID:64175See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 11, NCBI annotation release 103, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 57986.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000236040.8 ENSP00000236040.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000236040.8Link to Ensembl Protein Viewer:ENSP00000236040.4Re-query CCDS DB by Nucleotide ID:ENST00000236040Re-query CCDS DB by Protein ID:ENSP00000236040
Original member NCBI NM_001243246.1 NP_001230175.1 Updated not alive Link to Nucleotide Sequence:NM_001243246.1Link to Protein Sequence:NP_001230175.1Re-query CCDS DB by Nucleotide ID:NM_001243246Re-query CCDS DB by Protein ID:NP_001230175
Current member NCBI NM_001243246.2 NP_001230175.1 Accepted alive Link to Nucleotide Sequence:NM_001243246.2Link to Protein Sequence:NP_001230175.1Re-query CCDS DB by Nucleotide ID:NM_001243246Re-query CCDS DB by Protein ID:NP_001230175Link to BLAST:NP_001230175.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001230175.1 804 Q32P28-3 804 100% 0 0

Chromosomal Locations for CCDS 57986.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 42746912 42747412 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 42747723 42747798 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 42748200 42748317 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 42750186 42750336 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 42752274 42752369 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 42752537 42752664 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 42754869 42754990 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 42755165 42755217 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 42755548 42755637 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 42757783 42757922 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 42758852 42758983 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 42759201 42759390 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 42762323 42762475 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 42766507 42766971 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2415 nt):
ATGGCGGTACGCGCGTTGAAGCTGCTGACCACACTGCTGGCTGTCGTGGCCGCTGCCTCCCAAGCCGAGG
TC
GAGTCCGAGGCAGGATGGGGCATGGTGACGCCTGATCTGCTCTTCGCCGAGGGGACCGCAGCCTACGC
G
CGCGGGGACTGGCCCGGGGTGGTCCTGAGCATGGAACGGGCGCTGCGCTCCCGGGCAGCCCTCCGCGCC
CTT
CGCCTGCGCTGCCGCACCCAGTGTGCCGCCGACTTCCCGTGGGAGCTGGACCCCGACTGGTCCCCCA
GC
CCGGCCCAGGCCTCGGGCGCCGCCGCCCTGCGCGACCTGAGCTTCTTCGGGGGCCTTCTGCGTCGCGC
T
GCCTGCCTGCGCCGCTGCCTCGGGCCGCCGGCCGCCCACTCGCTCAGCGAAGAGATGGAGCTGGAGTTC
CGC
AAGCGGAGCCCCTACAACTACCTGCAGGTCGCCTACTTCAAGATCAACAAGTTGGAGAAAGCTGTTG
CT
GCAGCACACACCTTCTTCGTGGGCAATCCTGAGCACATGGAAATGCAGCAGAACCTAGACTATTACCA
A
ACCATGTCTGGAGTGAAGGAGGCCGACTTCAAGGATCTTGAGACTCAACCCCATATGCAAGAATTTCGA
CTG
GGAGTGCGACTCTACTCAGAGGAACAGCCACAGGAAGCTGTGCCCCACCTAGAGGCGGCGCTGCAAG
AA
TACTTTGTGGCCTATGAGGAGTGCCGTGCCCTCTGCGAAGGGCCCTATGACTACGATGGCTACAACTA
C
CTTGAGTACAACGCTGACCTCTTCCAGGCCATCACAGATCATTACATCCAGGTCCTCAACTGTAAGCAG
AAC
TGTGTCACGGAGCTTGCTTCCCACCCAAGTCGAGAGAAGCCCTTTGAAGACTTCCTCCCATCGCATT
AT
AATTATCTGCAGTTTGCCTACTATAACATTGGGAATTATACACAGGCTGTTGAATGTGCCAAGACCTA
T
CTTCTCTTCTTCCCCAATGACGAGGTGATGAACCAAAATTTGGCCTATTATGCAGCTATGCTTGGAGAA
GAA
CACACCAGATCCATCGGCCCCCGTGAGAGTGCCAAGGAGTACCGACAGCGAAGCCTACTGGAAAAAG
AA
CTGCTTTTCTTCGCTTATGATGTTTTTGGAATTCCCTTTGTGGATCCGGATTCATGGACTCCAGAAGA
A
GTGATTCCCAAGAGATTGCAAGAGAAACAGAAGTCAGAACGGGAAACAGCCGTACGCATCTCCCAGGAG
ATT
GGGAACCTTATGAAGGAAATCGAGACCCTTGTGGAAGAGAAGACCAAGGAGTCACTGGATGTGAGCA
GA
CTGACCCGGGAAGGTGGCCCCCTGCTGTATGAAGGCATCAGTCTCACCATGAACTCCAAACTCCTGAA
T
GGTTCCCAGCGGGTGGTGATGGACGGCGTAATCTCTGACCACGAGTGTCAGGAGCTGCAGAGACTGACC
AAT
GTGGCAGCAACCTCAGGAGATGGCTACCGGGGTCAGACCTCCCCACATACTCCCAATGAAAAGTTCT
AT
GGTGTCACTGTCTTCAAAGCCCTCAAGCTGGGGCAAGAAGGCAAAGTTCCTCTGCAGAGTGCCCACCT
G
TACTACAACGTGACGGAGAAGGTGCGGCGCATCATGGAGTCCTACTTCCGCCTGGATACGCCCCTCTAC
TTT
TCCTACTCTCATCTGGTGTGCCGCACTGCCATCGAAGAGGTCCAGGCAGAGAGGAAGGATGATAGTC
AT
CCAGTCCACGTGGACAACTGCATCCTGAATGCCGAGACCCTCGTGTGTGTCAAAGAGCCCCCAGCCTA
C
ACCTTCCGCGACTACAGCGCCATCCTTTACCTAAATGGGGACTTCGATGGCGGAAACTTTTATTTCACT
GAA
CTGGATGCCAAGACCGTGACGGCAGAGGTGCAGCCTCAGTGTGGAAGAGCCGTGGGATTCTCTTCAG
GC
ACTGAAAACCCACATGGAGTGAAGGCTGTCACCAGGGGGCAGCGCTGTGCCATCGCCCTGTGGTTCAC
C
CTGGACCCTCGACACAGCGAGCGGGTGAGAGCAGCTCGAGCGGGTGAGAGCAGCTGGTGCTGTGGTGAC
CCG
TTCCCAGAGCGCCCTTGGTTTGCCTTTCTCTTCCCCAAATCCCATTGCCAGTGGCTGAGACACGAAA
GG
AGCACTTGGGACACCAGCTCCAACGCCCTGTCATTATGGTCACATTGCCTTGTCCTCCCTGGGCCTGC
T
GTGAACGGGATCCAGGTGGGGAAAGAGGTCAAGACAGGGAGCGATGCTGAGTTCTTGGTTCCCTCCTTG
GGC
CCCACTTCAGCTGTCCTTTTCCAGAGAGTAGGACCTGCTGGGAAGGAGATGAGCCTGGGGCCATTAA
GG
AACCTTCCTTGTCCCCTGGGAAGTAGCAGCTGA


Translation (804 aa):
MAVRALKLLTTLLAVVAAASQAEVESEAGWGMVTPDLLFAEGTAAYARGDWPGVVLSMERALRSRAALRA
L
RLRCRTQCAADFPWELDPDWSPSPAQASGAAALRDLSFFGGLLRRAACLRRCLGPPAAHSLSEEMELEF
R
KRSPYNYLQVAYFK
INKLEKAVAAAHTFFVGNPEHMEMQQNLDYYQTMSGVKEADFKDLETQPHMQEFR
L
GVRLYSEEQPQEAVPHLEAALQEYFVAYEECRALCEGPYDYDGYNYLEYNADLFQAIT
DHYIQVLNCKQ
N
CVTELASHPSREKPFEDFLPSHYNYLQFAYYN
IGNYTQAVECAKTYLLFFPNDEVMNQNLAYYAAMLGE
E
HTRSIGPRE
SAKEYRQRSLLEKELLFFAYDVFGIPFVDPDSWTPEEVIPKRLQEKQKSERETAVRISQE
I
GNLMKEIETLVEEKTKESLDVSRLTRE
GGPLLYEGISLTMNSKLLNGSQRVVMDGVISDHECQELQRLT
N
VAATSGDGYRGQTSPHTPNEKFYGVTVFKALKLGQEGKVPLQSAHLYYNVTEKVRRIMESYFRLDTPLY
F
SYSHLVCRTAIE
EVQAERKDDSHPVHVDNCILNAETLVCVKEPPAYTFRDYSAILYLNGDFDGGNFYFT
E
LDAKTVT
AEVQPQCGRAVGFSSGTENPHGVKAVTRGQRCAIALWFTLDPRHSERVRAARAGESSWCCGD
P
FPERPWFAFLFPKSHCQWLRHERSTWDTSSNALSLWSHCLVLPGPAVNGIQVGKEVKTGSDAEFLVPSL
G
PTSAVLFQRVGPAGKEMSLGPLRNLPCPLGSSS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser