NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS57665.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
57665.1 Public Mus musculus 9 Ncapd3 23 108 98 CCDS HistoryNCBI Gene:78658Re-query CCDS DB by CCDS ID:57665.1Re-query CCDS DB by GeneID:78658See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 57665.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000073127.13 ENSMUSP00000072871.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000073127.13Link to Ensembl Protein Viewer:ENSMUSP00000072871.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000073127Re-query CCDS DB by Protein ID:ENSMUSP00000072871
Original member Current member EBI,WTSI ENSMUST00000216677.1 ENSMUSP00000150938.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000216677.1Link to Ensembl Protein Viewer:ENSMUSP00000150938.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000216677Re-query CCDS DB by Protein ID:ENSMUSP00000150938
Original member Current member NCBI NM_178113.3 NP_835214.2 Accepted alive Link to Nucleotide Sequence:NM_178113.3Link to Protein Sequence:NP_835214.2Re-query CCDS DB by Nucleotide ID:NM_178113Re-query CCDS DB by Protein ID:NP_835214Link to BLAST:NP_835214.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_835214.2 1506 Q6ZQK0 1506 99.9336% 0 1

Chromosomal Locations for CCDS 57665.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 27030770 27030830 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27036985 27037139 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27041393 27041555 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27044496 27044680 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27045051 27045221 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27045528 27045589 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27045905 27045992 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27048155 27048288 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27050297 27050369 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27051362 27051487 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27051619 27051871 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27052324 27052380 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27052594 27052665 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27055472 27055545 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27056044 27056178 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27057861 27058081 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27063264 27063455 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27063770 27063867 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27063977 27064092 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27066943 27067050 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27069668 27069782 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27069875 27069982 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27071725 27071963 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27072723 27072802 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27082406 27082543 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27082830 27082963 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27083184 27083380 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27085940 27086050 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27087382 27087564 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27087979 27088196 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27088433 27088566 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27089300 27089377 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27094401 27094472 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27094561 27094621 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 27094697 27094805 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4521 nt):
ATGGCGCTGCAGGATCTTGGAGAAAACTTGCAGCCTTGGTGTCCGCTGGGTCTCAGCCTCGAATGGGTGA
AG
ACCGTGTGGGACCTGGACTTCACGGAGATTGAGCCTTTGGACCCCAGCATAGTAGGCGAGATCCTAGA
G
ACTGGAAGAGATGCGTTCACAAAGCTCTATGGAAGCCTCTTCCCCTTTGCGACTGACGAAAGTGGATCT
TTA
GAGAGCATCTGGACCTTCTTCACTGAGAATGACATTTCCAGTAACACACTGGTGGCATTGTTCTGTC
AC
TTCGTCCAGGAAGCCCATAAAAAAAGTGCCAGTGCACAATATCGAGAGTATGGCCTTCATGCTGCTGG
G
CTCTATTTCTTGCTGTTAGAAATACCAGGCAGCGTGGTCAATCAAGTGTTCCACCCAGTGATGTTTGAC
AAG
TGTATTCAGATTCTGAAGAGGAGCTGGCCACAAGAATCTAACTTGACTCAGAAAAGAAAAAAGGACC
AC
TCCAAGAGTTCTAAGGATAATTATAGGAAGAGCAGAAAAAGAGGAAAACCACCTAGAAAAGAGGATTA
T
CAGGTGGATGAACTTTCAAGAGAGGAAGAGGAAGAGGAAGAGGAGATTTATTTTTCTGGCCGGGACCTT
TGT
CAAATACGAGATGCCATATTTAATCTTCTAAAGAATTTTTTAAGGCTTCTGCCCAAGTTTTCTCTTA
AA
GAAAAACCACAGTCTATTCAAACTTGTATAGAGGTATTTGTTGCATTAACTAGTTTTGAGCCAATTCC
T
CATAAATTTCTTATTTCACAAGCCAGGAACCTCAATGAAGTCAAACACATATCAGAGCTGGCCTACTAT
GGA
CTGTATTTGCTGTGCTCCCCAGTACATGGAGAGGAAAATAAGGTTATTGGTTCTATTTTCCATCAAA
TG
CTAAATGTGATATTGATGTTAGAAGTAGGGGAAGGGTCCCGCTGTGCCCCCCTAGCCATAACCTCACA
A
GTCATCAATTGTAGAAACCAGGCAGTCCAGTTTGTCAGCTCACTTGTGGATGAACTACAAGCAAGTGTG
TAC
CCAGTCCTTGGTACTCTACTGCAGCATATCTGTGCCAAGGTGGTAGACAAAGCAGAGTATCGGACCT
AC
GCAGCACAGTCCCTGGTCCAGCTGCTGACTAAGCTTCCCTCTGAGGAGTATGCCACATTCATTGCCTG
G
CTTTACAAATATTCACGAAGTTCCAAGATTCCACACCGGGTCTTCACTCTTGATGTGGCTTTAGCTCTC
TTA
ACGCTGCCTGAAAGAGAGCTGGATGACACTGTATCTTTGGAGCATCAGAAGTTTCTAAAGCATAAAT
TC
TTTGTGCAAGAAATTATATTTGATCGCTGCTTAGACAAGGCACCTACTGTCCGCAGCAAGGCACTGTC
C
AGCTTTGCACATTGTCTGGAGTTGTCTTCTAGCAACACATCTGAGAGTATATTGGAAATCTTCATTAAC
A
GT
AATCTAGTTCCAGGGATACAGAATCTCTCTAACACCGTACTGAATCCCTCACCAGTGCTAACCAGTC
GA
AATGGCTACTCCGCGCAAAGCCGTACCCATAACAATGATGAACAGACTCTGCCTGGAGAAAGATGCTT
C
ATGACAATGCTGAGAAAAAGAATCAAGGATGAGAAAATCAATGTCAGGAAGTCTGCACTCCAGGTGTTA
ATG
AGCATTTTGAAACACTGTGACATCTTGAGCATGGAGCAGGACCTGTTGATCCTGCAGGACCATTGTC
GA
GACCCTGCCATATCTGTGCGGAAGCAAGCCCTACAGTCTCTTACAGAACTTGTTATGGCCCAACCTAC
A
TGTGTCCCAGTCCAGAAAGCCTGGTTGATGGGTGTCATCCCAGTGGTGATGGACTGTGAGAGCACAGTG
CAA
GAGAAGGCCTTGGAGTGCCTGGACCAGCTCCTGCTGCAGAACATTAAGCATCACAAGAAATTTCACA
GT
GCAGACAGAAGCCAGGTGCTTGCGTGGTCCCTACTTGCTCTCCTCACCATAGAGAACCAGGATCTGAG
A
CGCTATTTAAATAAGGCTTTTCATATCTGGTCCAAGAAAGATAAATTCTCATCCACTTTTATAAACAGT
GTG
ATATCCCACACTGACACAGAACGTTCTGCACCAGCCTGGATGCTGCTGTCCAAGATCACTTGCTCAT
CA
CCCAAGCTGGACTACACCAAAATAATAGAGTCGTGGGAGAGACTCAGCAGAGAACAGTCTCCCAACTC
A
AACACCTTAGGCTATATGCTGTGTGTCATTGGGCATATTGCAAAGCATCTTCCCAAGGGGACCCGGGAC
AAG
ATAACTGGTGTGATCAAGGCCAAGCTGAATGGATTTCAGTGGTCTCCAGAGCTGATCAGTTCGTCTG
TT
GACGCATTGCAAAAGCTTTGCAGGGCATCTGCCAAGACAGTGCTGGAAGAGCAGGGACTGCTGAAGCA
G
GTGTGTGGGGATGTGCTCGCCACCTGTGAGCAACACCTCTCTAACATCCTTCTGAAGGAAGATGGGACA
GGG
AACATGGATGAAGGCCTGGTGGTGAAATGTATCTTTACCCTAGGAGACATAGCCCAGTTATGTCCAG
CC
ATAGTAGAGAAGCGAGTCTTCCTTCTAATCCAGTCGATTCTGGCCTCTTCTGCTCATTCGGATCACTT
A
CCATCATCTCAAGGGACCACAGACGCCCTCGACAGTCAGCCTCCTTTCCAGCCCAGAAGCTCCGCCATG
CCT
TCTGTGATTAGAGCACATGCCATCATCACTTTAGGTAAACTCTGTTTACAGCATGAAGACCTTGCAA
AG
AAAAGCATCCCAGCCCTTGTGCGAGAACTTGAAGTGAGTGAGGATGTGGCTGTCCGCAACAATGTCAT
C
ATTGTGATATGTGATCTTTGTATCCGGTACACTGTCATGGTGGACAATTATATTCCCAACATTTCTGTC
TGC
CTGAAGGATTCAGACCCGTTCATCCGAAAGCAGACACTGGTCTTGCTTACCAACCTCTTACAGGAGG
AA
TATGTGAAGTGGAAGGGCTCTCTGTTCTTCCGATTTGTCAGCACTTTGGTGGACTCACACCCAGACAT
T
GCCAGCCTTGGGGAGTTCTGCCTGGCTCACTTGTTGCTGAAGAGGAACCCTACCATGTTTTTCCAGCAC
TTC
ATTGAGTGCATATTCCACTTCAACAGCTATGAGAAGCATGGGCAGTATAACAAGTTTTCCCAGTCAG
AG
AGGGGGAAGCAGCTGTTTTTACTAAAGGGAAAGACAAACAAGGAGAAGCGAATGAGAATCTACAAGTT
T
CTTCTTGAGCACTTCACAGACGAGCAGCGGTTCAATGTCACTTCCAAGATCTGTCTTAACATTTTGGCA
TGC
TTCACGGATGGCATCCTGCCCATGGACATGGAAGCCAGCGAGTTGCTCTCAGATACCTTTGACATCC
TC
AACTCCAAGGAGATCAAACTATTGGCAATGAGAGCACAGACATCCAAGGACCTCCTGGAAGAAGATGA
C
GTGGCTCTGGCAAATGTGGTCATGCAGGAAGCACAGATGAAGATCATCTCACAGGTTCAAAAGAGGAAT
TTC
ATAGAGAATATTATTCCAATCATCATCTCCCTGAAGACTGTGCTGGAGAAAAATAAGATCCCTGCTT
TG
CGGGAACTCATGAACTACCTGAGGGAAGTTATGCAAGATTACCGGGATGAAATCAACGATTTCTTTGC
A
GTTGACAAACAGCTGGCATCTGAACTTGAGTATGACATGAAGAAGTATAATGAGCAGCTAGCCCAGGAG
CAA
GCTCTGACAGAACATGCTAATGCAACCAAAGGGCCTGAAGACAGTGACAGGGTACCCTCTGCTCAGG
TT
GCTCCAGACTTAGAAGCTGTACCTGCTCTTGCTGCTGCTCCTATGGCTGCTGCTGCTGCTGCTGCTCC
T
ATGGCTGCTGCTGCTGCTGCTGCTGGCCAGGACAATGCTGATGTGCCTCCAACCCAGAGCCGGCCTTCA
GCA
CCTAGGTCCAACTTCACACCAACTTTGCCTCCCATATCCGAAAATGGACCTCTGAAGATAATGTCCA
GT
ACCAGGCCCATGTCTCTCAGTACCATCGCCATCCTGAATTCAGTCAAGAAAGCTGTTGCGTCTAAGAA
T
AGGACACGCAGTTTAGGAGCCTTGCCTTTCAATGTGGAGACCGGAAGCCCAGAAAATCCCTCCAGCCAT
G
AA
TCTTCCTTAAGCTTGGAGAAAGAGTCTGACAGAACTGTCAACCATGTAACTAAACGGGCAATCAGCA
CC
CCAGAGAATTCCATCAGTGACGTCACATTTGCAGCAGGGGTCAGTTACATAGGGACACCAGCAACTTT
T
TTTACCAAAGAGAAACACGAAGCCCAAGAACAAGGAAGTGACATTTTATGTTTATCGCTGCTTGATAAA
AG
A
CCTCCACAGTCTCCACAGTGGAACGTAAAGTCCCCAGCCAGGAGTCACGGCAGCACAAGATCCAGCC
GG
AGGTCCCTTCGTAAGGCCCCCCTGAAGACAGCCAACTGA


Translation (1506 aa):
MALQDLGENLQPWCPLGLSLEWVKTVWDLDFTEIEPLDPSIVGEILETGRDAFTKLYGSLFPFATDESGS
L
E
SIWTFFTENDISSNTLVALFCHFVQEAHKKSASAQYREYGLHAAGLYFLLLEIPGSVVNQVFHPVMFD
K
CIQILKRSWPQESNLTQKRKKDHSKSSKDNYRKSRKRGKPPRKEDYQ
VDELSREEEEEEEEIYFSGRDL
C
QIRDAIFNLLKNFLRLLPKFSLKEKPQSIQTCIE
VFVALTSFEPIPHKFLISQARNLNEVKHISELAYY
G
LYLLCSPVHGEENK
VIGSIFHQMLNVILMLEVGEGSRCAPLAITSQVINCRNQAVQFVSSLVDELQASV
Y
PVLGTLLQHICAK
VVDKAEYRTYAAQSLVQLLTKLPSEEYATFIAWLYKYSRSSKIPHRVFTLDVALAL
L
TLPERELDDTVSLEHQKFLKHKFFVQEIIFDRCLDKAPTVRSKALSSFAHCLELSSSNTSESILEIFIN

S
NLVPGIQNLSNTVLNPSPVLTSRNGYSAQSRTHNNDEQTLPGERCFMTMLRKRIKDEKINVRKSALQVL
M
SILKHCDILSMEQDLLILQDHCRDPAISVRKQALQSLTELVM
AQPTCVPVQKAWLMGVIPVVMDCESTV
Q
EKALECLDQLLLQNIKHHKKFHSADRSQVLAWSLLALLTIENQDL
RRYLNKAFHIWSKKDKFSSTFINS
V
ISHTDTERSAPAWMLLSKITCSSPKLDYTKIIESWERLS
REQSPNSNTLGYMLCVIGHIAKHLPKGTRD
K
IT
GVIKAKLNGFQWSPELISSSVDALQKLCRASAKTVLEEQGLLKQVCGDVLATCEQHLSNILLKEDGT
G
NMDEGLV
VKCIFTLGDIAQLCPAIVEKRVFLLIQSILASSAHSDHLPSSQGTTDALDSQPPFQPRSSAM
P
SVIRAHAIITL
GKLCLQHEDLAKKSIPALVRELEVSEDVAVRNNVIIVICDLCIRYTVMVDNYIPNISV
C
LKDSDPFIRKQTLVLLTNLLQ
EEYVKWKGSLFFRFVSTLVDSHPDIASLGEFCLAHLLLKRNPTMFFQH
F
IECIFHFNSYEKHGQYNKFSQSE
RGKQLFLLKGKTNKEKRMRIYKFLLEHFTDEQRFNVTSKICLNILA
C
FTDGILPMDMEASELLSDTFDILNSKEIKLLAMRAQTSKDLLEEDDVALANVVMQEAQMKIISQ
VQKRN
F
IENIIPIIISLKTVLEKNKIPALRELMNYLR
EVMQDYRDEINDFFAVDKQLASELEYDMKKYNEQLAQE
Q
ALTEHANATKGPEDSDRVPSAQ
VAPDLEAVPALAAAPMAAAAAAAPMAAAAAAAGQDNADVPPTQSRPS
A
PRSNFTPTLPPISENGPLKIMSST
RPMSLSTIAILNSVKKAVASKNRTRSLGALPFNVETGSPENPSSH
E
SSLSLEKESDRTVNHVTKRAISTPENSISDVTFAAGVSYIGTPATFFTKEKHEAQEQGSDILCLSLLDK
R
PPQSPQWNVKSPARSHGSTRSSRRSLRKAPLKTAN



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser