NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS57648.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
57648.1 Public Mus musculus 8 Def8 23 108 98 CCDS HistoryNCBI Gene:23854Re-query CCDS DB by CCDS ID:57648.1Re-query CCDS DB by GeneID:23854See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 57648.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000108832.7 ENSMUSP00000104460.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000108832.7Link to Ensembl Protein Viewer:ENSMUSP00000104460.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000108832Re-query CCDS DB by Protein ID:ENSMUSP00000104460
Original member Current member NCBI NM_001253783.1 NP_001240712.1 Accepted alive Link to Nucleotide Sequence:NM_001253783.1Link to Protein Sequence:NP_001240712.1Re-query CCDS DB by Nucleotide ID:NM_001253783Re-query CCDS DB by Protein ID:NP_001240712Link to BLAST:NP_001240712.1

Chromosomal Locations for CCDS 57648.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 123446170 123446184 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123447317 123447363 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123447788 123447912 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123449301 123449398 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123452745 123452894 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123454229 123454370 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123455414 123455578 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123456406 123456533 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123456671 123456784 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123458351 123458431 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123459517 123459657 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123459817 123459926 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123461464 123461566 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1419 nt):
ATGCAGGGTGAAAGGGGAACATCTCAAGTAAGGGGACAGGAAGGAAGATCCAGTTCCAAGAGGTGGGATG
CT
ATGGAATATGATGAGAAGCTGGTTCGGTTCCGGCAGGCCCACCTCAACCCCTTCAACAAGCAGCTTGG
T
CCGAGGCATCATGAACAGGAACCCAGTGAGAAGGTCACTTCTGAAGACACTTTGCCTGAGCTGCCCGCT
GGG
GAGCCTGAATTCCACTACTCGGAGCGCATGATGGATCTCGGCCTGTCTGAGGACCACTTTTCCCGCC
CT
GTGGGTCTCTTCCTGGCCTCTGATGTCCAGCAGCTGCGGCAGGCCATCGAAGAATGCAAACAGGTGAT
C
CTGGAGCTGCCCGAGCAGTCAGAGAAGCAGAAGGACGCTGTGGTGCGGCTGATCCACCTCCGGCTGAAG
CTC
CAGGAGCTGAAGGACCCCAATGAGGAGGAACCCAACATCCGGGTTCTCCTGGAACATCGCTTCTACA
AG
GAGAAGAGCAAGAGCGTTAAACAGACCTGCGATAAGTGCAACACCATCATCTGGGGGCTCATCCAGAC
C
TGGTACACCTGCACAGGGTGTTGTTACCGCTGTCACAGCAAGTGCCTGAACCTCATCTCCAAACCATGT
GTC
AGCTCCAAGGTCAGTCACCAGGCTGAGTATGAGCTGAACATCTGCCCTGAGACCGGGCTGGACAGCC
AG
GACTACCGCTGTGCGGAGTGCCGTGCTCCCATCTCTCTGAGAGGTGTGCCTAGTGAGGCCCGGCAGTG
T
GACTACACGGGCCAATACTACTGCAGCCACTGCCACTGGAACGACCTGGCTGTCATCCCCGCGAGAGTG
GTG
CACAACTGGGACTTTGAGCCACGCAAGGTGTCCCGTTGCAGCATGCGCTACCTGGCACTGATGGTGT
CT
CGGCCAGTGCTCCGGCTCCGGGAGATTAACCCTTTGCTGTTTAACTACGTGGAAGAGCTGGTGGAGAT
C
CGGAAACTGCGCCAGGACATCCTGCTCATGAAGCCATACTTCATCACCTGCAAGGAGGCCATGGAGGCG
CGA
CTACTGCTGCAGCTCCAAGACAGACAGCATTTTGTGGAGAACGATGAGATGTACTCTATCCAGGACC
TC
TTGGAAGTGCACATGGGCCGCCTCAGCTGCTCGCTCACTGAGATCCACACGCTCTTCGCCAAGCACAT
C
AAGTTGGACTGTGAGCGGTGCCAAGCCAAGGGGTTCGTCTGTGAACTCTGCAAAGAAGGGGACGTGCTC
TTC
CCGTTCGACAGCCACACGTCTGTGTGCAATGACTGTTCGGCTGTCTTCCACAGGGACTGTTACTACG
AC
AACTCGACCACGTGCCCCAAGTGTGCCCGGCTCACATTGAGGAAGCAGTCACTATTCCAGGAACCTGG
C
CTAGACATGGATGCCTAG


Translation (472 aa):
MQGERGTSQVRGQEGRSSSKRWDAMEYDEKLVRFRQAHLNPFNKQLGPRHHEQEPSEKVTSEDTLPELPA
G
EPEFHYSERMMDLGLSEDHFSRPV
GLFLASDVQQLRQAIEECKQVILELPEQSEKQKDAVVRLIHLRLK
L
QELK
DPNEEEPNIRVLLEHRFYKEKSKSVKQTCDKCNTIIWGLIQTWYTCTGCCYRCHSKCLNLISKPC
V
SSKVSHQAEYELNICPETGLDSQDYRCAECRAPISL
RGVPSEARQCDYTGQYYCSHCHWNDLAVIPARV
V
HNWDFEPRK
VSRCSMRYLALMVSRPVLRLREINPLLFNYVEELVEIRKLRQDILLMKPYFITCKEAMEA
R
LLLQ
LQDRQHFVENDEMYSIQDLLEVHMGRLSCSLTEIHTLFAKHIKLDCERCQAKGFVCELCKEGDVL
F
PFDSHTSVCNDCSAVFH
RDCYYDNSTTCPKCARLTLRKQSLFQEPGLDMDA



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser