NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS5760.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
5760.1 Public Homo sapiens 7 FOXP2 22 109 92 CCDS HistoryNCBI Gene:93986Re-query CCDS DB by CCDS ID:5760.1Re-query CCDS DB by GeneID:93986See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 5760.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000350908.8 ENSP00000265436.7 Accepted alive Link to Ensembl Transcript Viewer:ENST00000350908.8Link to Ensembl Protein Viewer:ENSP00000265436.7Re-query CCDS DB by Nucleotide ID:ENST00000350908Re-query CCDS DB by Protein ID:ENSP00000265436
Original member Current member EBI ENST00000393494.6 ENSP00000377132.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000393494.6Link to Ensembl Protein Viewer:ENSP00000377132.2Re-query CCDS DB by Nucleotide ID:ENST00000393494Re-query CCDS DB by Protein ID:ENSP00000377132
Original member NCBI NM_014491.3 NP_055306.1 Updated not alive Link to Nucleotide Sequence:NM_014491.3Link to Protein Sequence:NP_055306.1Re-query CCDS DB by Nucleotide ID:NM_014491Re-query CCDS DB by Protein ID:NP_055306
Current member NCBI NM_014491.4 NP_055306.1 Accepted alive Link to Nucleotide Sequence:NM_014491.4Link to Protein Sequence:NP_055306.1Re-query CCDS DB by Nucleotide ID:NM_014491Re-query CCDS DB by Protein ID:NP_055306Link to BLAST:NP_055306.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_055306.1 715 O15409-1 715 100% 0 0

Chromosomal Locations for CCDS 5760.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 7 (NC_000007.14)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 114426512 114426679 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 114534617 114534706 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 114628540 114628677 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 114629805 114630005 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 114631528 114631705 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 114642410 114642623 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 114644685 114644789 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 114652203 114652290 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 114653926 114654009 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 114658066 114658267 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 114659356 114659432 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 114659572 114659673 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 114662065 114662186 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 114663450 114663519 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 114664273 114664436 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 114689782 114689926 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2148 nt):
ATGATGCAGGAATCTGCGACAGAGACAATAAGCAACAGTTCAATGAATCAAAATGGAATGAGCACTCTAA
GC
AGCCAATTAGATGCTGGCAGCAGAGATGGAAGATCAAGTGGTGACACCAGCTCTGAAGTAAGCACAGT
A
GAACTGCTGCATCTGCAACAACAGCAGGCTCTCCAGGCAGCAAGACAACTTCTTTTACAGCAGCAAACA
AGT
GGATTGAAATCTCCTAAGAGCAGTGATAAACAGAGACCACTGCAGGTGCCTGTGTCAGTGGCCATGA
TG
ACTCCCCAGGTGATCACCCCTCAGCAAATGCAGCAGATCCTTCAGCAACAAGTCCTGTCTCCTCAGCA
G
CTACAAGCCCTTCTCCAACAACAGCAGGCTGTCATGCTGCAGCAGCAACAACTACAAGAGTTTTACAAG
AAA
CAGCAAGAGCAGTTACATCTTCAGCTTTTGCAGCAGCAGCAGCAACAGCAGCAGCAGCAACAACAGC
AG
CAACAACAGCAGCAGCAACAACAACAACAACAGCAGCAACAACAGCAGCAGCAGCAGCAACAGCAGCA
G
CAGCAGCAACAGCATCCTGGAAAGCAAGCGAAAGAGCAGCAGCAGCAGCAGCAGCAGCAACAGCAATTG
GCA
GCCCAGCAGCTTGTCTTCCAGCAGCAGCTTCTCCAGATGCAACAACTCCAGCAGCAGCAGCATCTGC
TC
AGCCTTCAGCGTCAGGGACTCATCTCCATTCCACCTGGCCAGGCAGCACTTCCTGTCCAATCGCTGCC
T
CAAGCTGGCTTAAGTCCTGCTGAGATTCAGCAGTTATGGAAAGAAGTGACTGGAGTTCACAGTATGGAA
GAC
AATGGCATTAAACATGGAGGGCTAGACCTCACTACTAACAATTCCTCCTCGACTACCTCCTCCAACA
CT
TCCAAAGCATCACCACCAATAACTCATCATTCCATAGTGAATGGACAGTCTTCAGTTCTAAGTGCAAG
A
CGAGACAGCTCGTCACATGAGGAGACTGGGGCCTCTCACACTCTCTATGGCCATGGAGTTTGCAAATGG
CCA
GGCTGTGAAAGCATTTGTGAAGATTTTGGACAGTTTTTAAAGCACCTTAACAATGAACACGCATTGG
AT
GACCGAAGCACTGCTCAGTGTCGAGTGCAAATGCAGGTGGTGCAACAGTTAGAAATACAGCTTTCTAA
A
GAACGCGAACGTCTTCAAGCAATGATGACCCACTTGCACATGCGACCCTCAGAGCCCAAACCATCTCCC
AAA
CCTCTAAATCTGGTGTCTAGTGTCACCATGTCGAAGAATATGTTGGAGACATCCCCACAGAGCTTAC
CT
CAAACCCCTACCACACCAACGGCCCCAGTCACCCCGATTACCCAGGGACCCTCAGTAATCACCCCAGC
C
AGTGTGCCCAATGTGGGAGCCATACGAAGGCGACATTCAGACAAATACAACATTCCCATGTCATCAGAA
ATT
GCCCCAAACTATGAATTTTATAAAAATGCAGATGTCAGACCTCCATTTACTTATGCAACTCTCATAA
GG
CAGGCTATCATGGAGTCATCTGACAGGCAGTTAACACTTAATGAAATTTACAGCTGGTTTACACGGAC
A
TTTGCTTACTTCAGGCGTAATGCAGCAACTTGGAAGAATGCAGTACGTCATAATCTTAGCCTGCACAAG
TGT
TTTGTTCGAGTAGAAAATGTTAAAGGAGCAGTATGGACTGTGGATGAAGTAGAATACCAGAAGCGAA
GG
TCACAAAAGATAACAGGAAGTCCAACCTTAGTAAAAAATATACCTACCAGTTTAGGCTATGGAGCAGC
T
CTTAATGCCAGTTTGCAGGCTGCCTTGGCAGAGAGCAGTTTACCTTTGCTAAGTAATCCTGGACTGATA
AAT
AATGCATCCAGTGGCCTACTGCAGGCCGTCCACGAAGACCTCAATGGTTCTCTGGATCACATTGACA
GC
AATGGAAACAGTAGTCCGGGCTGCTCACCTCAGCCGCACATACATTCAATCCACGTCAAGGAAGAGCC
A
GTGATTGCAGAGGATGAAGACTGCCCAATGTCCTTAGTGACAACAGCTAATCACAGTCCAGAATTAGAA
GAC
GACAGAGAGATTGAAGAAGAGCCTTTATCTGAAGATCTGGAATGA


Translation (715 aa):
MMQESATETISNSSMNQNGMSTLSSQLDAGSRDGRSSGDTSSEVSTVELLHLQQQQALQAARQLLLQQQT
S
GLKSPKSSDKQRPLQ
VPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQALLQQQQAVMLQQQQLQEFYK
K
QQEQLHLQLLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQHPGKQAKE
QQQQQQQQQQL
A
AQQLVFQQQLLQMQQLQQQQHLLSLQRQGLISIPPGQAALPVQSLPQ
AGLSPAEIQQLWKEVTGVHSME
D
NGIKHGGLDLTTNNSSSTTSSNTSKASPPITHHSIVNGQSSVLSARRD
SSSHEETGASHTLYGHGVCKW
P
GCESICEDFGQFL
KHLNNEHALDDRSTAQCRVQMQVVQQLEIQLSKERERLQAMMTHLHMRPSEPKPSP
K
P
LNLVSSVTMSKNMLETSPQSLPQTPTTPTAPVTPITQGPSVITPASVPNVGAIRRRHSDKYNIPMSSE
I
APNYEFYKNADVRPPFTYATLIRQ
AIMESSDRQLTLNEIYSWFTRTFAYFRRNAATWKNAVRHNLSLHK
C
FVRVENVKGAVWTVDEVEYQKRRSQKIT
GSPTLVKNIPTSLGYGAALNASLQAALAESSLPLLSNPGLI
N
NASSGLLQAVHEDLNGSLDHIDSNGNSSPGCSPQPH
IHSIHVKEEPVIAEDEDCPMSLVTTANHSPELE
D
DREIEEEPLSEDLE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser