NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS57581.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
57581.1 Public Mus musculus 7 Mical2 21 106 86 CCDS HistoryNCBI Gene:320878Re-query CCDS DB by CCDS ID:57581.1Re-query CCDS DB by GeneID:320878See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 57581.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000037991 ENSMUSP00000047639 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000037991Link to Ensembl Protein Viewer:ENSMUSP00000047639Re-query CCDS DB by Nucleotide ID:ENSMUST00000037991Re-query CCDS DB by Protein ID:ENSMUSP00000047639
Original member Current member EBI,WTSI OTTMUST00000058251 OTTMUSP00000028195 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000058251Link to Vega Protein Viewer:OTTMUSP00000028195Re-query CCDS DB by Nucleotide ID:OTTMUST00000058251Re-query CCDS DB by Protein ID:OTTMUSP00000028195
Original member Current member NCBI NM_001193305.1 NP_001180234.1 Accepted alive Link to Nucleotide Sequence:NM_001193305.1Link to Protein Sequence:NP_001180234.1Re-query CCDS DB by Nucleotide ID:NM_001193305Re-query CCDS DB by Protein ID:NP_001180234Link to BLAST:NP_001180234.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001180234.1 1102 Q8BML1-2 1102 100% 0 0

Chromosomal Locations for CCDS 57581.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 112271306 112271569 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 112303588 112303795 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 112307004 112307120 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 112309426 112309527 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 112311316 112311471 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 112314972 112315072 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 112318386 112318643 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 112319712 112319827 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 112320607 112320733 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 112321346 112321436 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 112322516 112322663 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 112323478 112323677 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 112323975 112324081 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 112328652 112328720 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 112331896 112332039 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 112333829 112333954 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 112334938 112335156 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 112335329 112335430 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 112336849 112336974 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 112345246 112345353 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 112346722 112346908 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 112349394 112349482 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 112351325 112351427 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 112353899 112353939 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3309 nt):
ATGGGAGAGAATGAAGATGAGAAGCAGGCGCAGGCCAGCCAGGTCTTCGAGAACTTTGTGCAAGCTACCA
CA
TGCAAAGGGACCCTCCAGGCCTTCAACATCCTCACCTGCCTCCTGGACCTAGATCCGCTGGACCATAG
G
AACTTCTACTCCCAGCTCAAGTCCAAGGTGAACACCTGGAAGGCCAAAGCCCTGTGGCACAAACTGGAT
AAG
CGCGGCTCCCACAAGGAGTACAAGCGAGGAAAAGCCTGCTCGAACACTAAGTGTCTCATCGTCGGAG
GA
GGACCATGTGGCTTGCGCACTGCCATTGAACTTGCCTACCTGGGAGCCAAAGTGGTTGTGGTGGAGAA
G
AGGGACACCTTCTCCCGGAACAATGTCCTGCACCTCTGGCCCTTCACTATCCATGACCTGCGGGGCCTG
GGG
GCCAAGAAGTTCTATGGGAAATTCTGTGCTGGCTCCATCGACCACATCAGTATCCGACAACTGCAGC
TT
ATCCTCTTCAAGGTGGCCCTGATGCTGGGAGTGGAGGTCCACGTGAATGTGGAGTTTGTGAGGGTGCT
G
GAGCCTCCTGAAGACCAAGAGAATCAAAAAGTTGGATGGCGGGCAGAATTCCTTCCTGCAGACCACGCC
CTG
TCTGACTTTGAGTTTGATGTCATCATCGGTGCTGACGGTCACAGGAACACGCTAGAAGGCTTCAGGA
GG
AAAGAGTTCCGAGGGAAGCTGGCCATCGCCATCACCGCCAACTTCATAAACAGGAACAGCACAGCTGA
G
GCCAAGGTGGAGGAGATCAGTGGTGTTGCCTTCATCTTCAACCAGAAGTTCTTCCAGGACCTGAAGGAA
GAA
ACAGGGATTGATCTCGAGAACATTGTTTACTATAAGGACAGTACCCACTACTTTGTCATGACAGCCA
AG
AAGCAGAGCCTGCTGGACAAGGGCGTCATCCTTAATGACTACATTGACACAGAGATGCTGCTGTGTTC
G
GAGAATGTGAACCAGGACAACCTGCTCTCCTACGCCAGAGAAGCCGCTGACTTTGCCACCAACTACCAG
CTG
CCATCCTTAGACTTTGCCATCAATCACAACGGGCAGCCTGACGTGGCCATGTTCGACTTCACCTCCA
TG
TATGCCTCAGAGAACGCAGCTCTGATGCGTGAGCGCCAGGCACACCAGCTGCTCGTGGCTCTTGTGGG
C
GACAGCCTGCTTGAGCCATTTTGGCCCATGGGCACAGGCTGTGCCCGAGGCTTCCTGGCAGCCTTTGAC
ACG
GCATGGATGGTGAAGAGCTGGGACCAGGGCACCCCTCCCCTGGAGGTATTAGCTGAAAGAGAGAGTC
TT
TACAGGCTGTTACCTCAGACAACCCCAGAGAACATCAACAAAAATTTTGAGCAGTACACATTGGACCC
A
GCCACGCGGTACCCAAACCTCAACCTGCACTGCGTCAGGCCTCACCAGGTGAAGCATTTGTACATCACT
AAG
GAGATGGACCGCTTCCCTCTCGAGAGATGGGGCTCAGTGAGGAGATCTGTCAGCCTCTCCAGGCGGG
AG
TCAGACATCCGGCCTAACAAGCTTTTAACCTGGTGCCAGCAGCAGACCAAGGGTTACCAGCACGTCAG
A
GTCACTGACCTGACCACATCCTGGCGCAGCGGCTTGGCCCTGTGTGCCATCATCCACAGCTTCCGGCCA
GAG
CTGATCAACTTTGACTCGCTGAATGAAGATGACGCTGTGGAGAACAACCAACTGGCATTTGATGTGG
CC
AAGCGTGAGTTTGGGATCCTGCCTGTGACCACAGGCAAAGAGATGGCATCTACCCAGGAGCCAGACAA
G
CTCAGCATGGTCATGTACCTCTCCAAGTTCTATGAGCTCTTCCGGGGCACTCCACTGAGACCCATGGAT
TCC
TGGCGTAAAAACTATGGAGAAAATGCTGACTTTGGCTTGGGCAAAACATTCATTCAGAATAACTATC
TC
AACCTCACATTGCCCAGAAAGAGGACCCCACGGGTAGACACCCAGACTGAAGAGAATGACATGAACAA
G
AGGCGGCGACAAGGCTTCAACCACCTGGAAGAGCTGCCATCCTTCTCCAGCCGCAGCCTGGGCTCCAGT
CAA
GAGTATGCTAAAGAAAGTGGCAGTCAGAACAAGGTCAAGCACATGGCCAATCAGCTGCTAGCCAAGT
TT
GAGGAGAACACTCGGAACCCTTCAGTCGTGAAACAGGACTGCCGCCGGGTCTCAGGCATAGGTAAGCC
T
GTCCTGTGCTCTGCCTCTCGCCCTCCTGGCACCTCTTGCTGCCCCAAGCTGGAGGAGTCCACTCCCAGG
CTT
CCACCTCCTCTGAAAAGGCAGTTCTCCTCCACGGTGGCAACAGGACAGGTGCTCAGAGAACTCAACC
AA
GTACCGGCTAGTGGCGAGTGCCCCAGCAGACCCTGGAGAGCCAGGGCCAAGTCAGACCTGCAACTGGG
T
GGGGTTGAAAATCTCGCTACCCTGCCTCGCACCTGCCAAGGGGCACTGGCCCTGTCCGGGGTGCTGCGG
CGC
CTACAGCAAGTAGAAGAAAAGGTGCTTCAGAAGAGGGCCCAGAACTTGGCTAACAGGGAATTTCACA
CA
AAGAACATTAAAGAGAAGGCAGCTCACCTGGCCTCCATGTTTGGACACGGGGATTTACCACAGGATAA
G
CTCCTATCTAAACGCGTGCCTCACGCTCATCCTCCATCTCCTCCCTCTTGCCTTCCGTCTCCTCATCCA
GCT
GCTGCTTCCTCTCCACCCGCTGCCGACTCTGTTTCTCCTGCCAGAAAGCTGACAGTAGGGAAAGTAT
CC
AGCGGAATAGGGGCTGCAGCTGAAGTTCTGGTCAATCTGTACTTGAATGATCACAGACCTAAGACACA
G
GCCACCTCTCCAGACCTGGAATCCCCGAGAAAGGCATTCCCCCTGAGCCTGGGCGGCAGAGACACCTGC
TAC
TTTTGTAAGAAGCGTGTATACATGATAGAGCGGCTGAGTGCTGAGGGCCACTTTTTCCACCAAGAGT
GC
TTCCGTTGCAGCGTCTGCAGTGCCACCCTGCGCCTGGCTGCCTATGCCTTTGACTGCGATGAAGGCAA
A
TTTTACTGCAAGCCCCATTTTGTTCACTGCAAAACCAGTAGCAAACAGCGAAAGAGACGGGCAGAGCTG
AAT
CAGCAAAGAGAGGAGGAAGGAACATGGCAGGAGCAGGAAGCACCTCGGAGGGATGTACCCACAGAAA
GC
TCTTGTGCAGTGGCGGCCATCAGCACGCCAGAAGGCAGCCCCCCAGTACGTTTCAGCCTTCCAGTCCT
A
CACCCACTTCTTGGCTGA


Translation (1102 aa):
MGENEDEKQAQASQVFENFVQATTCKGTLQAFNILTCLLDLDPLDHRNFYSQLKSKVNTWKAKALWHKLD
K
RGSHKEYKRGKACSNTK
CLIVGGGPCGLRTAIELAYLGAKVVVVEKRDTFSRNNVLHLWPFTIHDLRGL
G
AKKFYGKFCAGSIDHI
SIRQLQLILFKVALMLGVEVHVNVEFVRVLEPPEDQENQKVGWRAEFLPADHA
L
SDFEFDVIIGADGHRNTLE
GFRRKEFRGKLAIAITANFINRNSTAEAKVEEISGVAFIFNQKFFQDLKE
E
T
GIDLENIVYYKDSTHYFVMTAKKQSLLDKGVILNDYIDTEMLLCSENVNQDNLLSYAREAADFATNYQ
L
PSLDFAINHNGQPDVAMFDFTSMYASENAALMRERQAHQLLVALVGDSLLE
PFWPMGTGCARGFLAAFD
T
AWMVKSWDQGTPPLEVLAE
RESLYRLLPQTTPENINKNFEQYTLDPATRYPNLNLHCVRPHQVKHLYIT
K
EMDRFPLERWGSVRRSVSLSRR
ESDIRPNKLLTWCQQQTKGYQHVRVTDLTTSWRSGLALCAIIHSFRP
E
L
INFDSLNEDDAVENNQLAFDVAKREFGILPVTTGKEMASTQEPDKLSMVMYLSKFYELFRGTPLRPMD
S
WRKNYGENADFGLGKTFIQNNYLNLTLPRKRTPR
VDTQTEENDMNKRRRQGFNHLEELPSFSSRSLGSS
Q
EYAKESGSQNKVKHMANQLLAKFEENTRNPSVVKQ
DCRRVSGIGKPVLCSASRPPGTSCCPKLEESTPR
L
PPPLKRQ
FSSTVATGQVLRELNQVPASGECPSRPWRARAKSDLQLGGVENLATLPRTCQGALALSGVLR
R
LQQVEEKVLQ
KRAQNLANREFHTKNIKEKAAHLASMFGHGDLPQDKLLSKRVPHAHPPSPPSCLPSPHP
A
AASSPPAADSVSPARK
LTVGKVSSGIGAAAEVLVNLYLNDHRPKTQATSPDLESPRKAFPLSLGGRDTC
Y
FCKKRVYMIERLSAEGHFFHQECFRCSVCSATLRLAAYAFDCDE
GKFYCKPHFVHCKTSSKQRKRRAEL
N
QQRE
EEGTWQEQEAPRRDVPTESSCAVAAISTPEGSPPVRFSLPVLHPLLG



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser