NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS57416.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
57416.1 Public Mus musculus 6 Ahcyl2 23 108 98 CCDS HistoryNCBI Gene:74340Re-query CCDS DB by CCDS ID:57416.1Re-query CCDS DB by GeneID:74340See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 57416.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000102995.8 ENSMUSP00000100060.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000102995.8Link to Ensembl Protein Viewer:ENSMUSP00000100060.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000102995Re-query CCDS DB by Protein ID:ENSMUSP00000100060
Original member Current member NCBI NM_001171000.2 NP_001164471.2 Accepted alive Link to Nucleotide Sequence:NM_001171000.2Link to Protein Sequence:NP_001164471.2Re-query CCDS DB by Nucleotide ID:NM_001171000Re-query CCDS DB by Protein ID:NP_001164471Link to BLAST:NP_001164471.2

Chromosomal Locations for CCDS 57416.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 29768538 29768906 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29863143 29863251 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29870568 29870711 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29871186 29871286 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29878529 29878631 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29880549 29880643 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29883623 29883729 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29886118 29886234 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29890681 29890744 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29891201 29891289 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29894819 29894889 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29896322 29896416 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29903189 29903287 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29906508 29906576 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29906681 29906759 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29908347 29908467 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 29909040 29909046 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1839 nt):
ATGTCGGTGCAGGTTGTGTCAGCAGCGGCAGCCGCCAAGGTGCCTGAGGTGGAGCTGAAGGATCTGAGCC
CC
TCCGAGGCGGAGCCCCAGTTGGGACTGAGCGCGGCGGCCGTGGGCGCCATGGTACCCCCAGCGGGTGG
C
GGGGACCCAGAGGCTCCAGCTCCGGCTCCCGCGGCGGAGCGGCCCCCGGCCCCCGGCCCGGGCTCGGGG
CCC
ACCGCGGCTCTGAGCCCTGCGGCCGGGAAGGTCCCTCAAGCGTCCGCCATGAAGCGGAGCGACCCTC
AT
CACCAGCACCAGCGGCATCGCGACGGCGGCGAGGCCTTGGTCAGCCCCGACGGCACGGTCACCGAGGC
G
CCGCGCACGGTCAAGAAGATTCAGTTTGCTGACCAGAAGCAGGAATTCAACAAACGTCCCACCAAAATC
GGA
CGTCGCTCTTTGTCTCGTTCCATCTCTCAGTCATCTACTGACAGCTATAGCTCAGCTGCCTCATATA
CA
GATAGCTCTGACGATGAGACATCCCCCAGGGACAAGCAGCAAAAGAACTCTAAGGGAAGTAGCGACTT
C
TGTGTCAAGAACATCAAACAAGCGGAGTTTGGACGCAGAGAAATTGAAATTGCTGAGCAAGAGATGCCT
GCC
TTGATGGCTTTAAGGAAGAGAGCCCAAGGAGAAAAGCCTTTGGCTGGAGCCAAAATTGTGGGTTGTA
CG
CACATCACTGCTCAGACAGCCGTGCTTATGGAGACACTGGGTGCTCTGGGGGCACAGTGCCGATGGGC
T
GCCTGCAACATCTACTCCACCCTCAATGAAGTGGCTGCTGCTCTCGCAGAAAGTGGGTTTCCCGTCTTT
GCC
TGGAAAGGAGAATCAGAAGATGACTTTTGGTGGTGCATTGACAGATGCGTGAATGTGGAGGGCTGGC
AG
CCAAACATGATACTGGATGATGGAGGAGATCTGACTCACTGGATTTATAAAAAGTATCCCAACATGTT
T
AAAAAAATCAAAGGCATAGTCGAGGAGAGTGTTACTGGAGTCCATAGGCTGTACCAACTGTCCAAAGCT
GGG
AAGCTGTGTGTTCCCGCCATGAACGTCAATGACTCAGTCACTAAGCAGAAATTTGATAACCTCTACT
GT
TGCCGTGAATCTATTCTTGACGGACTTAAAAGGACAACAGATATGATGTTTGGTGGAAAGCAGGTGGT
G
GTCTGTGGCTATGGAGAGGTGGGAAAGGGGTGCTGCGCTGCTCTGAAAGCCATGGGCTCCATTGTGTAC
GTG
ACTGAGATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGATGGATTCCGACTAGTGAAGCTGAATG
AA
GTCATCCGACAGGTCGACATTGTTATTACTTGCACAGGGAACAAGAATGTGGTAACCAGAGAGCACTT
G
GACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGCCATTCCAACACCGAGATTGATGTGGCCAGC
CTG
CGGACACCAGAACTGACCTGGGAGAGAGTAAGATCCCAAGTTGATCATGTGATATGGCCTGATGGCA
AG
AGGATAGTACTGCTGGCAGAGGGCCGTCTACTGAATCTCAGCTGCTCCACAGTGCCTACATTTGTGCT
C
TCCATCACTGCTACCACTCAGGCTCTCGCCTTGATAGAACTTTACAATGCTCCTGAGGGTCGCTATAAG
CAA
GATGTGTACCTGCTACCCAAGAAAATGGATGAGTATGTGGCAAGCCTACACCTGCCCACCTTTGATG
CC
CACCTGACAGAGCTAACAGATGAACAAGCCAAGTATCTGGGACTCAACAAGAATGGACCCTTCAAGCC
T
AACTACTACAGGTATTAA


Translation (612 aa):
MSVQVVSAAAAAKVPEVELKDLSPSEAEPQLGLSAAAVGAMVPPAGGGDPEAPAPAPAAERPPAPGPGSG
P
TAALSPAAGKVPQASAMKRSDPHHQHQRHRDGGEALVSPDGTVTEAPRTVKK
IQFADQKQEFNKRPTKI
G
RRSLSRSISQSSTDSYSS
AASYTDSSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMP
A
LMALRKRAQGEKPLAGAKIVGCTHITAQTA
VLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVF
A
WKGESEDDFWWCIDRCVNVEGWQPNM
ILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKA
G
KLCVPAMNVNDSVTKQKFDNLYCCRESILD
GLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVY
V
TEIDPICALQA
CMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVAS
L
RTPELTWERVRSQVDHVIWPDGKRIVLLAE
GRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYK
Q
DVYLLPKKM
DEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYRY



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser