NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS57073.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
57073.1 Public Mus musculus 17 Bag6 23 108 98 CCDS HistoryNCBI Gene:224727Re-query CCDS DB by CCDS ID:57073.1Re-query CCDS DB by GeneID:224727See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 57073.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000166426.8 ENSMUSP00000129324.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000166426.8Link to Ensembl Protein Viewer:ENSMUSP00000129324.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000166426Re-query CCDS DB by Protein ID:ENSMUSP00000129324
Original member NCBI NM_001252468.1 NP_001239397.1 Updated not alive Link to Nucleotide Sequence:NM_001252468.1Link to Protein Sequence:NP_001239397.1Re-query CCDS DB by Nucleotide ID:NM_001252468Re-query CCDS DB by Protein ID:NP_001239397
Current member NCBI NM_001252468.2 NP_001239397.1 Accepted alive Link to Nucleotide Sequence:NM_001252468.2Link to Protein Sequence:NP_001239397.1Re-query CCDS DB by Nucleotide ID:NM_001252468Re-query CCDS DB by Protein ID:NP_001239397Link to BLAST:NP_001239397.1

Chromosomal Locations for CCDS 57073.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 35136128 35136235 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 35138372 35138489 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 35138586 35138782 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 35139235 35139309 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 35140233 35140489 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 35140822 35140951 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 35141426 35141623 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 35141830 35142082 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 35142307 35142384 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 35142727 35142839 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 35142923 35143010 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 35143333 35143682 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 35144151 35144442 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 35144599 35144768 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 35144946 35144999 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 35145137 35145239 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 35145329 35145453 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 35145606 35145752 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 35145862 35145921 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 35146026 35146169 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 35146246 35146353 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 35146757 35146903 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 35147141 35147236 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3411 nt):
ATGGAGCCGAGTGATAGTGCCAGTACCGCTATGGAGGAGCCTGACAGCCTGGAGGTACTGGTGAAGACCC
TG
GACTCTCAGACTCGGACTTTTATTGTGGGGGCCCAGATGAATGTAAAGGAGTTTAAGGAACACATAGC
T
GCCTCTGTCAGCATCCCTTCCGAGAAACAGCGGCTCATCTACCAGGGCCGGGTCCTACAAGACGACAAG
AAG
CTCCAGGAGTACAACGTTGGGGGAAAGGTTATTCACCTGGTGGAACGGGCTCCTCCTCAGACTCAGC
TT
CCTTCTGGAGCATCTTCTGGGACAGGCTCTGCCTCAGCAACTCATGGTGGGGCACCCCTGCCTGGCAC
T
CGGGGCCCTGGGGCTTCTGTTCATGACCGGAATGCCAACAGCTATGTCATGGTTGGAACCTTCAATCTT
CCT
AGTGAGCCCCGGGTCCGGCTGGTGATGGCTCAGCACATGATTAGGGATATACAGACCTTACTGTCCC
GG
ATGGAGTGTCGAGGGGGAACCCAAGCTCAGGCCAGTCAGCCACCCCCGCAGACACCGCAGACTGTGGC
C
TCAGAGACGGTAGCCTTGAACTCACAAACATCAGAACCAGTCGAAAGTGAAGCTCCTCCTCGAGAGCCC
ATG
GAGTCAGAAGAAATGGAGGAACGTCCCCCAACCCAGACTCCAGAGCTTGCGCCCTCAGGCCCAGCTC
CC
GCAGGCCCAGCTCCCGCAGGCCCAGCTCCCGCGCCAGAGACAAATGCACCCAACCACCCTTCCCCCGC
A
GAGCACGTGGAGGTGCTCCAGGAGCTTCAGCGCTTGCAGCGCCGTCTTCAGCCTTTCCTACAGCGCTAC
TGC
GAGGTCCTGGGCGCTGCTGCCACCACAGACTACAACAACAACCATGAGGGCCGTGAGGAGGACCAGA
GG
TTGATCAACTTGGTTGGGGAGAGCCTGCGGCTACTGGGCAACACTTTCGTGGCATTGTCTGATCTGCG
C
TGCAATCTAGCCTGTGCACCCCCACGGCACCTGCACGTGGTTCGGCCTATGTCTCACTACACGACTCCC
ATG
GTGCTCCAGCAGGCAGCCATTCCCATTCAGATCAATGTGGGGACTACTGTGACCATGACAGGCAATG
GG
GCTCGGCCTCCACCAGCTCCTGGTGCGGAGGCAGCAACCCCAGGTTCTGCCCAGGCCACATCCCTGCC
T
CCCTCTTCCACCACTGTTGATTCATCAACTGAAGGAGCTCCCCCACCAGGGCCAGCACCGCCACCAGCC
TCC
AGCCACCCACGGGTCATCCGGATTTCCCACCAGAGTGTGGAGCCCGTGGTCATGATGCACATGAACA
TT
CAAGATTCTGGAGCACAGCCTGGTGGTGTGCCAAGTGCTCCCACTGGTCCACTGGGACCTCCTGGTCA
T
GGACAGACCCTGGGACAGCAGGTGCCCGGCTTCCCAACAGCACCAACTCGGGTGGTGATTGCCCGGCCA
ACT
CCTCCACAGGCTCGGCCTTCCCATCCTGGGGGACCTCCAGTCTCTGGAGCTCTGCAGGGCGCTGGGC
TG
GGTACAAACACTTCATTGGCCCAGATGGTGAGCGGCCTTGTGGGGCAACTTCTTATGCAGCCTGTTCT
T
GTGGCTCAGGGGACTCCAGGAATGGCTCAGGCTCAGGCCCAGGCCCAGGCTCAGGCCCAGGCCCAGGCC
CAG
GCTCCAGCTCCGGCTCCGGCTCCAGCTCCAGCTCCTGCCACTGCTTCAGCTAGTGCTGGTACTACCA
AC
ACAGCTACCACAGCTGGCCCTGCTCCTGGGGGTCCTGCCCAGCCTCCACCTCCTCAGCCCTCTGCAGC
T
GATCTTCAGTTCTCTCAGCTCCTGGGAAATCTGCTGGGGCCTGCAGGGCCAGGGGCTGGGGGGCCAGGC
ATG
GCTTCTCCCACCATCACTGTGGCAATGCCTGGTGTCCCTGCTTTTCTCCAGGGCATGACTGATTTTT
TG
CAGGCATCACAGACTGCCCCTCCACCCCCTCCACCTCCTCCACCCCCACCCCCTGCCCCAGAGCAGCA
G
AGCACACCCCCACCAGGGTCTCCTTCTGGTGGAACAGCAAGCCCTGGAGGCTTAGGTCCTGAGAGCCTG
CCA
CCAGAGTTTTTCACCTCAGTGGTGCAGGGCGTGTTGAGCTCCCTCCTGGGCTCCTTGGGGGCTCGAG
CT
GGCAGCAGTGAGAGTATCGCTGCCTTCATCCAACGCCTCAGTGGATCCAGCAACATCTTTGAGCCTGG
G
GCTGATGGCGCCCTTGGATTCTTCGGAGCTCTGCTCTCTCTCCTGTGCCAGAATTTCTCCATGGTGGAT
GTG
GTGATGCTTCTCCATGGCCATTTCCAGCCACTGCAGCGGCTCCAGCCACAGCTGCGATCTTTCTTCC
AC
CAGCACTACCTGGGTGGCCAGGAGCCCACGCCTAGCAACATCCGGATGGCGACCCACACACTGATCAC
T
GGGCTGGAAGAGTATGTAAGGGAGAGTTTTTCTTTGGTACAGGTTCAGCCAGGTGTGGATATCATCCGG
ACA
AATTTAGAATTTCTCCAAGAGCAGTTTAACAGCATTGCTGCTCATGTGCTGCACTGTACAGACAGTG
GA
TTTGGAGCCCGGTTGCTGGAGCTGTGTAACCAGGGCCTGTTTGAATGCTTGGCCCTGAACCTCCACTG
C
TTGGGGGGACAGCAAATGGAGCTTGCTGCTGTCATCAATGGTCGAATTCGCCGCATGTCTCGCGGGGTG
AAT
CCATCCTTGGTGAGCTGGCTGACAACCATGATGGGACTGAGGCTTCAGGTGGTCTTGGAGCACATGC
CT
GTGGGTCCCGACGCCATCCTCAGATATGTTCGTAGGGTTGGTGATCCTCCTCAGACACTTCCTGAAGA
G
CCGATGGAAGTTCAGGGAGCAGAAAGAACTTCCCCTGAACCTCAGAGAGAGAATGCTTCCCCAGCCCCT
GGA
ACAACAGCAGAAGAAGCCATGTCCCGAGGCCCGCCCCCTGCTCCTGAAGGAGGTTCCCGAGATGAAC
AG
GATGGAGCTTCAGCTGATGCAGAACCCTGGGCAGCTGCAGTCCCCCCTGAATGGGTCCCTATTATCCA
G
CAGGACATTCAGAGCCAGCGGAAGGTGAAACCTCAGCCGCCCCTGAGTGATGCCTACCTCAGTGGCATG
CCT
GCCAAGAGACGAAAGACAATGCAGGGTGAGGGCCCCCAGCTGCTACTCTCAGAGGCAGTGAGCCGGG
CA
GCTAAGGCAGCCGGAGCTCGGCCCCTGACAAGCCCCGAGAGCCTGAGCCGGGACCTGGAGGCACCAGA
G
GTTCAGGAGAGCTACAGGCAGCAGCTCCGGTCTGATATCCAAAAACGACTGCAGGAAGATCCCAACTAC
AGC
CCCCAGCGCTTCCCTAATGCCCATCGGGCATTTGCTGATGACCCCTAG


Translation (1136 aa):
MEPSDSASTAMEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDK
K
LQEY
NVGGKVIHLVERAPPQTQLPSGASSGTGSASATHGGAPLPGTRGPGASVHDRNANSYVMVGTFNL
P
SEPRVRLVMAQHMIRDIQTLLSRMECRGGTQAQASQPPPQTPQTVASETVALNSQTSEPVESEAPPREP
M
ESEEMEERPPTQTPELAPSGPAPAGPAPAGPAPAPETNAP
NHPSPAEHVEVLQELQRLQRRLQPFLQRY
C
EVLGAAATTDYNNN
HEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACAPPRHLHVVRPMSHYTTP
M
VLQQAAIPIQ
INVGTTVTMTGNGARPPPAPGAEAATPGSAQATSLPPSSTTVDSSTEGAPPPGPAPPPA
S
SHPRVIRISHQSVEPVVMMHMNIQ
DSGAQPGGVPSAPTGPLGPPGHGQTLGQQVPGFPTAPTRVVIARP
T
PPQARPSHPGGPPVSGAL
QGAGLGTNTSLAQMVSGLVGQLLMQPVLVAQGTPGMAQAQAQAQAQAQAQA
Q
APAPAPAPAPAPATASASAGTTNTATTAGPAPGGPAQPPPPQPSAADLQFSQLLGNLLGPAGPGAGGPG
M
ASPTITVAMPGVPAFLQGMTDFLQ
ASQTAPPPPPPPPPPPPAPEQQSTPPPGSPSGGTASPGGLGPESL
P
PEFFTSVVQGVLSSLLGSLGARAGSSESIAAFIQRLSGSSNIFEPGADGAL
GFFGALLSLLCQNFSMVD
V
VMLLHGHFQPLQRLQPQLRSFFHQHYLGGQEPTPSNIR
MATHTLITGLEEYVRESFSLVQVQPGVDIIR
T
NLEFLQEQFNSIAAHVLHCT
DSGFGARLLELCNQGLFECLALNLHCLGGQQMELAAVINGRIRRMSRGV
N
PSLVSWLTTMMGLRLQVVLEHMPVGPDAILRYVRRVGDPPQ
TLPEEPMEVQGAERTSPEPQRENASPAP
G
TTAEEAMSRGPPPAPEGGSRDEQDGASADAEPWAAAVPP
EWVPIIQQDIQSQRKVKPQPPLSDAYLSGM
P
AKRRK
TMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNY
S
PQRFPNAHRAFADDP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser