NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS56747.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
56747.1 Public Mus musculus 10 Otogl 21 106 86 CCDS HistoryNCBI Gene:628870Re-query CCDS DB by CCDS ID:56747.1Re-query CCDS DB by GeneID:628870See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)


Attributes
CDS uses downstream AUG
Inferred exon combination

Sequence IDs included in CCDS 56747.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000165341 ENSMUSP00000129467 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000165341Link to Ensembl Protein Viewer:ENSMUSP00000129467Re-query CCDS DB by Nucleotide ID:ENSMUST00000165341Re-query CCDS DB by Protein ID:ENSMUSP00000129467
Original member Current member EBI,WTSI OTTMUST00000113767 OTTMUSP00000063570 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000113767Link to Vega Protein Viewer:OTTMUSP00000063570Re-query CCDS DB by Nucleotide ID:OTTMUST00000113767Re-query CCDS DB by Protein ID:OTTMUSP00000063570
Original member NCBI NM_001177567.1 NP_001171038.1 Updated not alive Link to Nucleotide Sequence:NM_001177567.1Link to Protein Sequence:NP_001171038.1Re-query CCDS DB by Nucleotide ID:NM_001177567Re-query CCDS DB by Protein ID:NP_001171038
Current member NCBI NM_001177567.2 NP_001171038.1 Accepted alive Link to Nucleotide Sequence:NM_001177567.2Link to Protein Sequence:NP_001171038.1Re-query CCDS DB by Nucleotide ID:NM_001177567Re-query CCDS DB by Protein ID:NP_001171038Link to BLAST:NP_001171038.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001171038.1 2325 F7A4A7-1 2325 100% 0 0

Chromosomal Locations for CCDS 56747.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 107762310 107762510 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107763184 107763263 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107767766 107767811 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107768893 107769012 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107770540 107770644 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107771095 107771273 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107772266 107772329 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107777081 107777121 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107777208 107777312 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107777566 107777667 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107778855 107778962 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107779216 107779320 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107779715 107779927 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107780906 107781091 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107781928 107782069 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107783617 107783831 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107786758 107786947 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107789000 107789092 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107789183 107789206 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107789422 107789564 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107790486 107790663 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107794142 107794188 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107798322 107798360 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107798722 107798801 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107803578 107803695 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107806514 107806792 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107808609 107808776 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107812902 107812928 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107813913 107814069 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107817067 107817183 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107819937 107820056 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107821882 107822031 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107827673 107827807 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107853267 107853405 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107854246 107854353 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107856968 107857130 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107858895 107858947 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107861066 107861140 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107862145 107862310 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107866594 107866803 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107869478 107869602 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107874365 107874542 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107876798 107876921 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107877997 107878142 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107878567 107878613 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107879447 107879555 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107881351 107881476 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107881695 107881801 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107886467 107886573 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107886951 107887078 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107892069 107892274 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107895695 107895816 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107899460 107899614 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107901245 107901343 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107903049 107903115 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107909866 107909914 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107910920 107910959 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 107912077 107912128 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (6978 nt):
ATGGTACCTTGGCGTGCTCTCTCCCTTCCTATACTGCTGGTTTCATTACGAGGATACGTTTGTGCGTCAT
CT
GTCCTGTCAGAAACATCAGAAAGTGAGTTCTATGAAAATGAACAGAGAAGGGCTCTGTTAGCAGTACA
G
TTTGAAGCAACCTCTCCGAGATATTTTTTCCACGAAGCTATTAATTGGGGTGAGAGTAAAATAAAAGGT
TCA
TGTCCTCATGAATGCCTTAACGGGGCTTTCTGTTCTAAGACGGGTACGTGTGACTGTCAAATATTCC
AG
GCTCTCGGGACAAGGTGCCAGATTGTGCCAAACATGGGAAGTGGCAGAGATGGGATTTGCAAAACCTG
G
GGACAGTATCACTTTGAAACATTTGATGGAATCTACTATTATTTCCCAGGAAGTTGTTCTTATATATTT
GCA
AAGGACTGTGGTAATTTGGAGCCTCAGTACACAGTATGGGTCCATAATAGCCCAAAGTGCCTTGGTT
CC
GTGTATTCTTGTTACCGCTCCATCAGCTTATTTTTTTCAAACCAAGAGGAAATTAGAATCTATGGACA
T
GAAATAAGAAAAAATGGGATCAGTTTATCTCTGCCTCAGACACTTGGGCAGGTGCACTTAGAGAAGGTA
GCT
GACTACATTCTGGTGAAGACGACCTTTGGATTTTCTTTGGCTTGGGATGGAATATCGGGAATTTACC
TC
AAACTCTCGGAGGAGCACAGAGGGAAATCATGTGGCTTGTGTGCAAATTATAATGGCATCCAGTCAGA
C
GACTTTGTGATCCTGCAAGAGGACTACACAGAAGACATTGCTATGTTTGCAAATAGCTGGCTGGTGCTA
ACT
CCAGATGATACTAAATGTGTACCTACGCCCTCAGACTTTCCAAATCCATGTTCCAGTGGAATGCCAG
CA
TTTGAGGCAATCTTCTTCAAATGCCAGATATTGTTACAGTTCCCCTTTCTGAGCTGCCACGAATACAT
T
GATCCATACTTATACATTGCCAGCTGTGTTAATGACCTGTGCAAAACTGATGACGATGAAACTTACTGT
CGA
GCAGCCACAGAGTACGCTAGAGCCTGTTCCCACGCCGGCTTCCCCATTCAAGACTGGAGGGATGACT
TT
CCAGCATGCACTGATAAATGTGACGATAGCTTCGTCCACCGGGACTGTATCAGTTGTTGCCCTCCGAG
C
TGCACATTTGAGAAGCAGTGTCTTGGGAGCAATCTTCACTGCCTTGATGGATGCTATTGTGCAGACGGC
CTC
ATAATGGACAATGGAACTTGCATCTCTTTGGAGAGCTGCCCTTGTAGTTTTCACGGATTAGCTTATT
CA
GTTGGTTCAAAAATCGAACAAGAGTGCACTGAATGTGTATGTGTTGGTGGAGTTTGGAACTGCACCGA
A
CATGACTGTCCAGTTCAGTGTTCTGTTGTGGGTGACTCTCATTTCACCACCTTTGATGGGCGTCATTAC
TCT
TTTATTGGCTTGTGTCAGTACATCCTTGTGAAAGGAACTGGAAAAGATAGATTCACGATCACTTTGC
AG
AAGGCTCACTGTGAACAGAACCTGGGTTTGGTCTGCCTTCAGTCCATAACTCTAATACTGGAGGATGA
C
TTTAACAAACAAGTGACGCTCAGCAGAGGAGGCCAGATTGTCACCAGTCCCAACCAAGGCTTCACCCTG
AAC
GGCATTGTTGAAATTCAAACCCTGTCATCCTTATTCATTCTCCTAAGAACCACCTTTGGTTTAAAGA
TC
TTGTTCGCTATTGATGGAGAAAGAATTTACATTCAGCTTTCCAGTGCCTGGAAAAGAAGGACATTAGG
T
CTGTGCGGCACCTTTAATGGCAACATTAGGGATGATTTTCTTTCTCCATCAGGCATGATCGAAGGAACC
CCA
CAGCTCCACGCACATGCGTGGAGAGTCTCCTCCACGTGTTTCGCGCCTGTCCATGTCCCGATGGTGG
AT
CCCTGCAATATTAACCAACAGAACATTGGGTATGCAGCACACTGTGATGTCATCCACCAGGAGCTCTT
T
GCTCCTTGCCATGTCTACGTCAGTCCCGGGCTGTACTACCAGTTGTGTCGCCACGATGCCTGCAAATGT
GGG
AGCCCCTGCCTGTGTAACGCTCTCGCCCACTACGCCTACCTGTGTGGTCAGCGTGGTGTGCCCATTG
AT
TTCAGAGCTCACATCTCCTTCTGTGCTGTGGTGTGTCAGAAGGGCATGCTGTACCACCACTGCTCGTC
A
CTCTGCCTCCGCTCCTGCACCTCTCTCTCCTCCCCTGAGCAGTGCAAAGACGACTGTGCTGAAGGGTGC
AAC
TGTCCTGAAGGCAAATTCTATGAAGAGACACTTAACTTTTGTGTGCCCATATATCACTGCCGGTGTC
AT
TATAGGGGGAGCATTTACCAGCCAGGGGAGCTCATTCCAACCCCCTCAGGCTTATGCCAGTGTTCAAA
T
GGGACTGTGAAATGTGATGAGCTAGCAACACCCTCTACTGTCCACGCCTGCCCAGAAGGGAAGGAATAT
TTT
GACTGCAGGTTTCCTGACCCTGCGTTACCAGCTGGTGGTATAAACTGCGAGACGACGTGCGCAAACC
TG
GCCATGAACTTCACCTGTGCTCCATCCTCGCCTTGCATCAGTGGCTGCGTTTGTGCTGCAGGAATGGC
A
GAACACAAAGGAAAATGCTATGTTCCCGAAAGCTGTCCCTGCATCTGGAAGGACTGGGAGTACAGCTCA
GGG
GAGGTCATCTCTACACCGTGTTACACCTGTGTTTGTCGGCGGGGGATGTTCAATTGCACATATTATC
CA
TGTCCTGCAGTATGCACAGTATATGGGGACCGGCATTATCACTCCTTTGATGGATTGGAATATGACTA
T
ATCAGCGATTGCCAAGTGTTTTTGATAAAGAGTACAGACGATTCTGATATATCTGTGATTTCCCAAAAC
AAG
AAATGCTTTGACAATGATATTGTTTGTTCTAAAAGTGTTTTGATATCAATTGGAGACACTGAAATAT
AC
CTCAATGATGCTCCTTACAAACAGAAGCGATCAGGGTTTTTCCTGGAAAGCAGACCTGAGTACCAGCT
C
TGGAAGGCTGGGTTCTACATAGTAATATACTTCCCGGAGGAAGATATCACCATTCTGTGGGATGAGAAG
ACA
ACCATCCACATCAAAGTCGGGCCACAGTGGAAGAACAAGCTGGCAGGATTGTGTGGTAACTTTGACA
AA
TGTACTTCCAATGACATGACAACATCTAATAACATTGAAGTGCGAAATGCTCAGGTGTTTGGAGACAG
C
TGGGCCTTAGGACAGTGTGAAGATCTTATGGAGGCCCTGAAGCCCTGCGAGGCACACCAAAACAAATTT
CCC
TATGCCAAGAGAGAATGTTCCATTTTGTACAGTGATGTTTTTGCTCCTTGTCGCAATGTGATTGACG
TC
ACCTCTTTTGCCAAGAACTGCCATGAAGACACGTGTAACTGTAACCTGGGTGGGGACTGTGAATGCCT
A
TGTACCAGTGTGGCCGCATACGCTTACAAATGCTGCCAGGAAGGGGTGCCTGTTCACTGGAGGTCACCC
ACT
GTCTGTGCCCTTGACTGTGAATATTATAATCAAGGGCTTGGGGAAGGACCTTATATGCTGGCAAGTT
AT
GGGCAAAGTGGCCTTGTTCTTGGTGCCAATATGACCAGTAGAAGCGTTTTCTCTTTGCCCAGAAGCAA
C
AATCGTGGTAATTTATTTTTTATTTTTATGATCACTCCGGGCCTTTTCAAAGAGAAGACATCCTCATTG
GCT
CTTGTTTCCTTGGAATCTGCTGAAAGGCCCAACTACTTTCTCTATGTCCACGACAATGACACTCTTA
GC
TTGAAGCTGTGGCGGGCAAACTCAGAATTTCATCAGAGAGCAACATTTTTCCACCACCAAGGCCTCTG
G
ATTCCTGGCTACAGTGCATTCGAATTATACAGCAAGAAAGGCTACTTCATCGTTTTTATGGGTTCCAGT
GTC
AAAGCGTCAAAATACGATGACTCGGAAGAATTCAAGCAGTCAAGTAGCTTTAGCATAGAAGAAATCC
AG
GCAGTGGTCCCTTACAGGAGGATGTGCGAGTGGAGATACGAACCTTGTGCTACTCCGTGTTTTAAAAC
A
TGCAGTGATCCAGAGGCCTTAGCCTGTACATTCCTTCCACCGGTTGAAGGATGCTTGCCATATTGCCCC
AAG
AATATGATCCTGGATGAGACGACTCTTAAATGTGTTCACCCAGAAGACTGCATACCACTGTTTCCAA
CA
GAACCAGCATTGCCACCAGACATTACCCCATCAGACATGACACCGACCCCAGGTTTGGAATGCGAGCC
T
CAACAATTTGATCCTGTTTATAACTGTAGCCAATATATCTGCCTTAACATGGAGTGGACCTTCTACAAC
TGG
TCTCTGAATTGCCCGAAGGACTTGGAAATGCCCGACTGTGGGTTCCGAGGCTGGCCTGTTCAAGTGA
AT
ACTGATATATGCTGTCCGGAGTGGGAATGCCCCTGTCGGTGCTCCATGTTGTCAGAGTTGAGCATCAT
T
ACATTTGATGGGAACAGTGCAGCACTATCTAGTATGGCTTCTTACATCTTAGTAAGAGTCCCCGGGGAA
ATT
GTAGTTGTTCACATTGACAAATGTTCCATGAATCAGAATGGACATGCCCTTAAAAAACCAGCTTCTT
TT
GGACGAATCTCAGGACTTTGTTTTAAGAAGCTAAATGTGACAACATCTATACATAAAATACTTATCAA
C
AGAGTGGTAAGAAAGGTAGACGTGGATTCTATTGTTGTGCCTTTGCCCTTTTCAAGTCATGAGCTGTTC
ATA
GAAGATTCTGGAACAATGTATGTGATTACTACTCCTGCTGGCTTAATCATAAAGTGGGCTCACCTTA
CA
GGAATCATAGACATTCACTTCGGCCCCCAGTTTAACTTGTCATCTTACACAGAAGGGCTTTGTGGGAT
T
TGCAATGACAATCCAGATGATGACCTCAGGATGCAGAATGGCACCATCATTACCAACATGGAAGACATA
GAG
TTATTTATTGGCAGCTGGGAAATTGAGAAATCATTTGAAGTGACAATGAGAAGACCTGTGAGGAACT
GT
ACTGAATATGACTGCAGTCATTGCATCGAGTTATTGAACAGAGAAGGTTTCATTCCATGCCATGACAA
A
GTCTCACCAAGGGACTTTTGTGAAAAAATGTGGATCAACTACACCTACTTCTGGAGCTACGAATGTGAT
GCA
ATCTCTGCATATGTGGCTTTGTGCAACAAATTTGATATCTGCATTCAGTGGCGCACCCCTGACTATT
GC
CCTCTGAGTTGTCCAGAGGGAAAGGAATATCAGCCCTGTGTGAGACCATGTGAAGCAAGAACATGTCT
C
AACAAATGGTTCTATGGACACTCCTCATGTCTGAATTTGAGAGAAGACTGTGTGTGCAAGAATGGAACC
ATT
CTTCACCGGCCAGATAAAACACTATGCATCCCAGAGCAAGAATGTGTGTGCACTGACAGAGAGGAGC
AC
CCCCGCAGTGCTGGGGAGATTTGGAATGGTGGCATAGATGAATGCACCCTCTACAAATGTCTGGAGGA
T
GGAAACATTATTCCTATAGAGCCTGTCTGTGAAGAAGAGCCTTCCCCCATCTGTGAACGAACAGCTGAA
GTG
GTCATAGGCATTGTTGATAAGCTGACCTGCTGTTCTAAAAAAGTCTGTGGCTGTGACATGAGTTTGT
GT
GACAGGACCATCCCACCATGCACAAATAGCCAGAAGTTGATCGTTGGCTATAGTGCTCTTTCTTGTTG
C
CCACAGTATGAATGTGAATGTGATACGGTGAGATGTCCTGATATTTCAACGCCAGTTTGCAGAGATGAC
CAG
TTTGTGCTTCAAGTTCGACAGGGAGAGCCTTGCTGTTTCTACCCTTCCTGCGTTTGTAAGACATGCA
CT
GAACCAACTCCACAATGTACCGATGGGGAATTCCTCACTGTTAATATCAATACTACACATTTATGCTG
T
CCTCAGTACTACTGCGTTTGTGAGCCAGATCTTTGCCCTCCACCATCACTTGAGTGTGCAAAAGATATG
AAC
CTGGTGAAAGAAAATGTATCTGGACAATGTTGCCCAAACTGGCGTTGCGAATGCAACTGTGAGACTC
TT
GTCATGCCAACCTGTGACGTGGGAGAATTTGCTGCAATAGATCAAAACTTTCAGACTGACTGTGGCTG
T
GTACAGTATCTCTGTGAAAAGGATGATGTGTGTGTGTTCCAAGAAGTATCAGTATTGAATCCTGGGCAA
TCT
CTAATAAAGTATTTAGAAGAGGAATTTTGTTATATAATCGAATGTCTGGATGAAAAAGATAACTATA
CC
GACTTTCATACTTTGAATGTTACAATGGTGAACTGTTCAAAAGACTGTGATGCTCACCAGATATACAT
T
CCATCCTCCAGTGATTATGATTGCTGTGGAACATGTAAAAATATATCCTGCAAATTTATTATGGAAAAT
GGA
ACATCAGTTATATATGAGGAGGGGAGCACCTGGCACTATAACTGCAGCACGTACGAATGTGTTAACA
CT
GAGGAGGGAGCAACGATTCTAAACTACAGCATGGTTTGCCCTCCTTTTAATGAAACTGAATGCAAACT
G
AATGAAGGGATTGTGAAGCTTTATAATGAAGGCTGTTGCAAGATCTGCAAACGAGAAGAGCGAATATGC
CAG
AAAGTGATCATTAAATCCATCATAAAGAAACAGGACTGTGTAAGCCAAAGCTCTATTAGTGTGGCAT
CT
TGTGATGGGAAATGCCCGTCAGCTACCATATATAACATCAATGTTGAAAGTCACCTGAGGTTCTGCAA
G
TGCTGTCGTGAAAATGGAGTGCGAAACGTGACGGTGCCTCTGCACTGCTCAGGAAATGGCACTGAAGTA
ATG
TACACACTCCAGGAGCCGATAGACTGCACATGCCAGTGGAACTGA


Translation (2325 aa):
MVPWRALSLPILLVSLRGYVCASSVLSETSESEFYENEQRRALLAVQFEATSPRYFFHEAINWGESKIKG
S
CPHECLNGAFCSKTGTCDCQIFQALGTRCQI
VPNMGSGRDGICKTWGQYHFETFDGIYYYFPGSCSYIF
A
KDCGNLEPQYTVW
VHNSPKCLGSVYSCYRSISLFFSNQEEIRIYGHEIRKNGISLSLPQTLGQVHLEKV
A
DYILVKTTFGFSLAWDGISGIYLKLSEEHRGKSCGLCANYNGIQSDDFVILQ
EDYTEDIAMFANSWLVL
T
PDDTKCVPTPSDFPNPCSSGMPAFE
AIFFKCQILLQFPFLSCHEYIDPYLYIASCVNDLCKTDDDETYC
R
AATEYARACSHAGFPIQDWRDDFPAC
TDKCDDSFVHRDCISCCPPSCTFEKQCLGSNLHCLDGCYCADG
L
IMDNGTCISLESCPCSFHGLAYSVGSKIEQECTE
CVCVGGVWNCTEHDCPVQCSVVGDSHFTTFDGRHY
S
FIGLCQYILVKGTGKDRFTITLQKAHCEQ
NLGLVCLQSITLILEDDFNKQVTLSRGGQIVTSPNQGFTL
N
GIVEIQTLSSLFILLRTTFGLKILFAIDGERIYIQLSSAWKRRTLGLCGTFNGNIRDDFLSPSGMIEGT
P
QLHAHAWRVSSTCFAPVHVPMVDPCNINQQN
IGYAAHCDVIHQELFAPCHVYVSPGLYYQLCRHDACKC
G
SPCLCNALAHYAYLCGQRGVPIDFRAHISFC
AVVCQKGMLYHHCSSLCLRSCTSLSSPEQCKDDCAEGC
N
CPEGKFYEETLNFCVP
IYHCRCHYRGSIYQPGELIPTPSGLCQCSNGTVKCDELATPSTVHACPEGKEY
F
DCRFPDPALPAGGINCETTCANLAMNFTCAPSSPCISGCVCAA
GMAEHKGKCYVPESCPCIWKDWEYSS
G
EVISTPCYT
CVCRRGMFNCTYYPCPAVCTVYGDRHYHSFDGLEYDYISDCQVFLIKSTDDSDISVISQN
K
KCFDNDIVCSKSVLISIGDTEIYLNDAPYKQ
KRSGFFLESRPEYQLWKAGFYIVIYFPEEDITILWDEK
T
TIHIKVGPQWK
NKLAGLCGNFDKCTSNDMTTSNNIEVRNAQVFGDSWALGQCEDLMEALKPCEAHQNKF
P
YAKRECSILYSDVFAPCRNV
IDVTSFAKNCHEDTCNCNLGGDCECLCTSVAAYAYKCCQEGVPVHWRSP
T
VC
ALDCEYYNQGLGEGPYMLASYGQSGLVLGANMTSRSVFSLPRSNNRGNLFFIFMITPGLFKEKTSSL
A
LVSLESAERPNYFLYVHDNDTLSLKLWRANSEFHQRATFFHHQGLWIPGYSAFELYSKKGYFIVFMGSS
V
KASKYDDSEEFKQSSSFSIE
EIQAVVPYRRMCEWRYEPCATPCFKTCSDPEALACTFLPPVEGCLPYCP
K
NMILDETTLKCVHPED
CIPLFPTEPALPPDITPSDMTPTPGLECEPQQFDPVYNCSQYICLNMEWTFYN
W
SLNCPKDLEMPDCGFRGWPVQVNTDICCPEWECP
CRCSMLSELSIITFDGNSAALSSMASYILVRVPGE
I
VVVHIDKCSMNQ
NGHALKKPASFGRISGLCFKKLNVTTSIHKILINRVVRKVDVDSIVVPLPFSSHELF
I
EDSGTMYVITTPAGLIIKWAHLTGIIDIHFGPQFNLSSYTEGLC
GICNDNPDDDLRMQNGTIITNMEDI
E
LFIGSWEIEKSFEVTMRRPVRNCTEYDCSHCIELLNREGFIPCHDK
VSPRDFCEKMWINYTYFWSYECD
A
ISAYVALCNKFDICIQWRTPDYC
PLSCPEGKEYQPCVRPCEARTCLNKWFYGHSSCLNLREDCVCKNGT
I
LHRPDKTLCIPEQEC
VCTDREEHPRSAGEIWNGGIDECTLYKCLEDGNIIPIEPVCEEEPSPICERTAE
V
VIGIVDKLTCCSKKVC
GCDMSLCDRTIPPCTNSQKLIVGYSALSCCPQYECECDTVRCPDISTPVCRDD
Q
FVLQVRQGEPCCFYPSC
VCKTCTEPTPQCTDGEFLTVNINTTHLCCPQYYCVCEPDLCPPPSLECAKDM
N
LVKENVSGQCCPNWRC
ECNCETLVMPTCDVGEFAAIDQNFQTDCGCVQYLCEKDDVCVFQEVSVLNPGQ
S
LIKYLEEEFCYIIECLDEKDNYTDFHTLNVTMVNCSKDCDA
HQIYIPSSSDYDCCGTCKNISCKFIMEN
G
TSVIYE
EGSTWHYNCSTYECVNTEEGATILNYSMVCPPFNETECKLNEGIVKLYNEGCCKICKREERIC
Q
KVIIKSIIKKQDCVSQSS
ISVASCDGKCPSATIYNINVESHLRFCKCCRENGVRNVTVPLHCSGNGTEV
M
YTLQEPIDCTCQWN




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser