NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS56629.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
56629.1 Public Mus musculus 1 Dnah7a 23 108 98 CCDS HistoryNCBI Gene:627872Re-query CCDS DB by CCDS ID:56629.1Re-query CCDS DB by GeneID:627872See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 56629.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000094964.6 ENSMUSP00000092571.5 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000094964.6Link to Ensembl Protein Viewer:ENSMUSP00000092571.5Re-query CCDS DB by Nucleotide ID:ENSMUST00000094964Re-query CCDS DB by Protein ID:ENSMUSP00000092571
Original member Current member NCBI NM_001252070.1 NP_001238999.1 Accepted alive Link to Nucleotide Sequence:NM_001252070.1Link to Protein Sequence:NP_001238999.1Re-query CCDS DB by Nucleotide ID:NM_001252070Re-query CCDS DB by Protein ID:NP_001238999Link to BLAST:NP_001238999.1

Chromosomal Locations for CCDS 56629.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 53397107 53397313 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53405676 53405779 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53411506 53411683 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53413732 53413884 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53419545 53419775 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53423229 53423366 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53425167 53425352 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53427826 53427987 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53432891 53433091 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53433951 53434112 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53437431 53437607 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53444441 53444533 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53447318 53447512 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53448929 53449055 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53456536 53456871 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53457671 53457804 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53468620 53468810 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53472801 53472955 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53479652 53479815 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53483297 53483482 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53494578 53494758 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53495686 53496032 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53496816 53497146 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53501478 53501707 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53503504 53504376 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53518621 53518840 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53521098 53521224 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53522211 53522379 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53523789 53523944 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53524938 53525135 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53528673 53528897 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53531108 53531239 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53534421 53534597 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53535375 53535557 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53537497 53537646 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53540879 53541127 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53544428 53544526 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53547143 53547355 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53559040 53559167 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53559279 53559381 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53561902 53562070 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53565663 53565772 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53567035 53567247 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53577189 53577329 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53582494 53582692 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53584458 53584651 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53605798 53605984 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53617725 53618410 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53620643 53620789 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53623343 53623567 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53627034 53627112 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53630195 53630322 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53631466 53631738 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53635264 53635443 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53635994 53636177 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53640336 53640455 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53643441 53643566 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53647247 53647322 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53662328 53662508 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53663804 53663891 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53684841 53684899 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53684966 53685054 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53686499 53686607 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53698632 53698694 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53702018 53702080 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53706678 53706692 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (12075 nt):
ATGAGCAGCAAGAAGGATAAGCTATCCACTAAAGGCAAATCAAAGACGCCAGTGAGATTCCTACCACAGT
TG
CCTATGGATAAACTATCCAGCAAAGAAAAGGTCAAGCTGCCGACAACAGTCTTACCACAGTTATCTTT
G
ACAGGAGTCAAGCCCCAGTGGCAGCAGACTGCGCCATCATTCCATTTAAATATCAAACAGGAAAACCCA
GTT
CTAGAACCCTATACTGTTAAAAATGAGCAGTCGTTTGCTGAATACATGGAGCACTGCCAGAAAAAAG
GA
AAACTTCTGGACCAAATTGATGATGACCGTTCTGCACCATCAACTTCAAGATCAAAGATCAAATCTCC
A
CAAAAGGAGAGAGAGAATCTCAGAAGCACCCTTGCTAAAGTCATCATGCAAAAAGATGGTGGTTTAGAG
TCC
GATGTCATTGATGAGAGTGGTATTCCAAAAGAGACCACTTCTGCAACGGAGAAAGACATCTCGAGGT
AT
TACTACTACATTCGCCAAGGACTTGATACTGATCACGTTGCCCCAATGGAAGACTCTTGGCTGGAGCA
C
GTATTACAATTGGTTCCAGAGCATCTGAAAGTCCTGACTAATAGCATCAAGGTCTTGTCAGATGAGATA
AGA
GAAGATTATCTTCTTAGTGTAAAGAAATCCATAGTTGACTTTGTTTTAAAAGATCCCAGAGAAAAAG
AT
GATGATGGCAAGATAACTGAACTCCCACCTCACCGTGCTGAAATGGAAGTCTTGCCAAAGCCATGGAG
G
AGGTCTTTCCTATCTGCATGCAGTTACATTAGGGATCACTTGAATGCAATGAACCCAATGATGCTGGCC
GTG
CTAGATCTGTGGCATAGCACTTTTAAGAAATTACGTTTAGTTGACATAGAAGAGTTTCACAGCTGCC
AG
GATGCATTAGAGCTGTCAGAATTTCAGAACATTGTCATTAAACACATGGAATCTGCCAAGGAGACGCT
A
CTTAAAACGTGGTTTCCAGAAGTGCAGAATATTTTTAACCAAGGCAATAAAAAAAAGCAATTGCCAACT
GGC
AAGAGCACTGCCAAATTGGACTCTTTTTTCAACTGCGCTGCTACACTCATGACCTTACAGCTGCAGG
AC
CTCATTCTTGTCTCCATGCAAGACTTCACAGACCTCATCGCCCAACCTCTGGAATCAATTAGAGTTTT
T
GAACATCCAGGTTTCATCATGAGGCTGGTTCTTGATAAAGAGGCCATTAAGTTTGAACCCGAGTTTAAT
GAA
TACATAGATAGTCTTATAAATATCTATGAAATCATGATTAAGGCTGTCAGCTTTGTGCCAAGAGTTG
AG
ACAAAATTGTATTCCCAATGGGAAAGCAAATCTAAGCCAACAACCTTGAAGCCCATAATTCTGAATGA
A
ATCATAGACACTCATAAGGAAAAGATTAGAGAGGTGATTTTACGAGAGAGCGTGGCGCCAACCGAGCAC
CTC
AAAATGTATGACAAGTATCAGTTCTTGATTACTGGAAAAGCTGAGCGTGATATTGATGAGTTGCTGT
TT
CAAAATCAGAACTATGAGAGACTAATAGAGGAAATTCGCAAATACCAAAAGCTAGGAGAAGAAATACA
G
TACACATCTCAAAAGACTGTTTGTTTGGGAATGTTTGAAATGCACTGTGAGGAACTGATCAGATCTTTG
GTG
AAGCGAGCAGATGTCATCTGTGGGAAACTGATAGCCAAGATGTTCCGAGATCACCAGGAAGTAAACA
CA
ATGCTATGTGATGAGTTTGAGAAGATAGCTGAAAAGGCTCTGAGTACGCCTCTAAACACAGCTGAGCT
C
ATGGAGATGAAGGCTCATGTTCAAAAATTGGAGACAACTGACATGTTGGAGCTGGGACAGAGACTAGTG
GAT
TCTAAAATCTGCCTGGCCTTCCTTATCGAGTGCGTCAACTTTTCTCCTGCAGACATCAGACTAAATA
AG
AGTGTTTTCCAGTGGTATGGCAGAATGGGGGAGATTTTTGACGAGCACAGGAAAATCATTAAAGAGAA
A
ACAGAACTATATCAAGAATTCCTTAAGTTTCGGTGTGAGCGGTTTGTGGAGGAATTGGAGAGTTATGCT
AAA
CAAGTAGAAGAATTTCATGCATTTGGAGACCTGTTGGATGTGCAGAGGTACTTGCAAAAGGCCCAGG
TG
CTGAATGGCAAGTTGGATGCAGCAGCGGACAAGATTGATCAGTTCAATGCAGAAGAGGAGGCGTTTGG
C
TGGGTCCCATCAGCATATCCTCAACGTAAAAAGATCCAGGACGCTTTGAACCCTTATCTCCATCTCTAT
GAA
ACTGCTGTGGAGTTTAGTACCAAACACAGAGGGTGGACTGAAGGACCATACCACAAGGTGAACCCAG
AT
CAAGTAGAAGCAGATGTTGGGAATTACTGGAGAGGGCTGTATAAGCTAGAGAAGGTCTTCCATGATTC
T
CCAAATGCGCTGGCAATGACCAAGAAAGTGCACTCAATGGTTGAGGAGTTCAAGCAGTACATCCCTCTC
ATC
CAAGTATTCTGTAATCCTGGTCTGCGCCCCAGGCACTGGGAGGCCATGTCTACCATCGTTGGCTACC
CT
CTGCAGCCCTCGGATGACTCTACAGTCTTCTCTTTCATAGACATGAACCTGGAGCCATTTTTAGACAG
A
TTTGGAAGCATCAGTGAAGCAGCTAGCAAAGAATATTCTCTTGAAAAGGCCATGGATAAGATGATGACT
GAA
TGGGACTCCATGGAGTTTGTCATTCTTCCCTACAGAGAAAGTGGGACATACATTTTGTCCTCAGTTG
AT
GACATTCAGATGTTGTTGGATGACCACATTATCAAAACACAAACTATGCGAGGATCTCCTTTCATCAA
G
CCTTATGAAAAGCAGATGAGGGAATGGGAGGGCAAGCTGCTGCTGCTACAGGAGATCCTGGATGAGTGG
CTC
AAGGTACAAGCCACCTGGCTCTATCTGGAGCCCATTTTCAGCTCTCGGGACATTATGTCTCAAATGC
CA
GAAGAAGGCAGACGATTCACAGCTGTGGATAAAACCTGGAGGGATGTGATGAAAACGGTTGTACAAGA
T
AAGCAAGTCCTGGCAGTCGTGACTATCGAGCGGATGCTGGAGAGGCTGAAAAAGTCCAACGAACTCTTG
GAG
CTCATTCTTAAAGGGCTGAACGAGTACTTGGAAAAGAAGCGCCTCTTCTTCCCCAGGTTCTTCTTCC
TG
TCCAACGATGAGCTCCTCGAGATCCTGTCTGAGACCAAGGATCCCACCCGAGTGCAGCCTCACCTCAA
G
AAATGCTTTGAAGGAATTGCAAAGGTCGAATTTACAGAAACATTGGATATTACACATATGAAGAGTAGT
GAG
GGAGAAGTCGTGGAGCTTGTAGATACCATTTCAACAGCCAAAGCCAGGGGCCAGGTGGAGAAGTGGT
TG
GTTGAGTTAGAGAGGACTATGATTAAGTCCATTCACAAGGTGATTAGAGATGCAATTGTTGCCTATAC
C
AAAACTTCACGGATTAGTTGGGTAAGAGATTGGCCTGGACAGACTGTTCTCTGTGTATCTCAAACCTTT
TGG
ACGGTAGAAGTCCAAATCGCTATACCTGAGGGGCACCGGGCCCTTGAAGGCTACTTGGCAAAATGCA
AC
CATCAAATTGATGATATTGTCACATTGGTTCGTGGCAAATTGTCCAAGCAGAACCGTGTTACTCTGGG
A
GCCCTTGTGGTACTGGATGTTCACGCTAGAGATGTGCTTGCCAGCCTTGTAGATAAAAAGATCAGTGAT
GAC
TCGGACTTCCAGTGGTTAAGTCAGCTTAGATACTACTGGCAAGAAAATAATTTAGAAACAAAGATGA
TC
AATGCTGGTTTGCGATATGGCTATGAATATCTGGGAAATTCCCCTAGACTAGTCATAACCCCACTCAC
A
GACCGCTGTTACAGGACCTTATTTGGAGCCCTTCATCTGCACCTTGGAGGAGCACCTGAGGGCCCAGCT
GGC
ACCGGAAAGACAGAAACAACCAAGGATTTAGCAAAAGCGGTTGCCAAACAGTGTGTCGTTTTCAACT
GC
TCCGATGGGCTGGATTATTTGGCCTTAGGAAAATTCTTTAAGGGACTGTTATCCTGTGGAGCCTGGGC
T
TGCTTTGATGAGTTTAACAGAATTGATTTGGAAGTACTTTCTGTGGTTGCTCAACAAATCCTTACCATC
CAG
AGAGGCATTAATGCAGGTACCGATCTCCTAGTGTTTGAAGGAACAGAACTAAAACTTGACCCCACAT
GC
GCTGTCTTCATAACAATGAACCCTGGGTATGCTGGGCGGTCAGAGCTGCCAGACAATCTGAAGGCTCT
G
TTCCGGACAGTGGCCATGATGGTGCCTGACTATGCCATGATTGCCGAGATCGTGCTGTACTCTTGTGGC
TTT
GTCACTGCGCGGCCGCTGTCCATAAAGATTGTGGCGACATACCGCTTGTGCTCAGAGCAACTGTCCT
CC
CAGCATCACTATGACTACGGGATGCGAGCTGTGAAGTCTGTGCTCACAGCTGCTGGCAATCTGAAGCT
G
AAATATCCAAACGAAAATGAAGAAATTTTGCTACTTAGATCTATTATTGATGTAAATCTGCCGAAGTTT
TTA
TCCCATGATTTGCCACTCTTTGAGGGAATTACCTCAGATTTGTTTCCTGGGGTGAAATTACCAAAGC
CA
GATTACAATGATCTGCTGGCCGCCATCAGAGACAACTGCCACAGCATGAATTTGCAAATGACCGACTT
C
TTCTCTGAGAAGATCCTTCAGATCTATGAGATGATGATTGTGCGTCACGGTTTCATGATTGTTGGAGAG
CCA
TTTGGAGGGAAGACCAGTGCATATCGTGTTCTAGCTGGAGCATTAAATGACATTTGTGAAAAGGGAC
TA
ATGGAAGAAAACAAGGTTCAAATAACTGTTTTAAATCCCAAGTCTGTCACCATGGGCCAGCTTTATGG
G
CAGTTTGACTTGGTTTCCCATGAGTGGTCTGATGGGGTCCTGGCTGTTAGCTTTAGAGCGTTCGCAGCT
TCC
TCGACTCCAGACAGGAAGTGGTTAATCTTTGATGGGCCAGTTGATGCCGTGTGGATTGAGAACATGA
AC
ACTGTGCTGGATGACAACAAGAAGCTGTGTCTGATGAGTGGGGAGATTATTCAAATGTCACCACAAAT
G
AACCTGATTTTTGAACCGATGGATCTGGAAGTCGCCTCTCCAGCCACTGTTTCCCGGTGTGGCATGATC
TAC
ATGGAGCCTCACATGCTAGGCTGGAGACCACTGATGGTGTCCTGGATAAACACGTTACCACAGTCAG
TC
AGTATCATTCAGAAGGAATTTATAGAAGGCTTGTTTGATAGAATGGTCCCTCTCTCTGTTGAATTCAT
C
AGAAGGCATACAAAGGAGCTCTCTCCTACTTCAGATACAAACTTGGTCCGATCCTTAATGAATCTCATA
GAC
TGTTTTATGGATGACTTTGCTGATGAAAACAAACAAAAGGAAAGAAATGACCGAGAAAGTTTCTCTT
TG
CTGGAGGGCATTTTTCTGTTTTCATTGATCTGGTCTGTTGGTGCAACTTGTACAGATGATGATCGTCT
G
AAATTCGATAAGATCCTCCGAGAGCTTCTGGAAGGTCCAATTTCAAACCTAACTCGAAATAAGTTTAAG
TTA
CTGAGTGGTACTGAGCAAACATCCTCAAAGGTGTTTATAGTGCCATTTCCTGAGAAGGGAACAATCT
AT
GATTATCAGTTTATCCCAGAGGGCTTAGGAAGATGGGATAAATGGATAAAGGATTTGGCAGATACTCC
T
CCAATTCCCAAAGATGTACAGTTTAATGAGATCATTGTGCCAACTCTAGATACGATCCGTTACTCTGCT
CTA
ATGAATTTACTGACCACTCATCAAAAGCCTTCAATATTTGTAGGACCAACAGGAACTGGAAAGAGTG
TT
TATATCATTAATTTTCTTTTAAATCAACTCAATAAGGACATCTACAAACCTCTTATAGTTAACTTCTC
A
GCCCAAACTACAGCAGCCCAAACTCAGAATATCATCATGTCGAAACTGGACAAAAGAAGAAAAGGAGTT
TTT
GGCCCTCCTTTAGGCAAGAGAATGATAGTCTTTGTAGATGATGTGAATATGCCTGCCCGCGAGGTCT
AT
GGGGCTCAGCCTCCCATTGAATTACTTAGACAGTGGTTAGATCATTGGAATTGGTACGACCTCAAAGA
T
TGCTCTGTGATTAAACTAGTGGACATCCAGATCATGTGCGCTATGGGCCCTCCAGGTGGTGGCCGAAAT
CCA
ATAACCCCTCGTTACATGAGACATTTCAATATTGTAACCATCAATGAGTTTAGTAACAAGTCAATGT
TC
ACAATCTTCTCCAGAATCCTGGCCTGGCATCTAAGAACCTGTTATAAGTTTCCAGATGATTTTCTAGA
C
TTGACTACACAAATAGTGAATGGTACAATGGCCCTGTACAAAGATGCCATGAAGAATCTCTTACCTACT
CCA
GCTAAATCTCACTATTTGTTCAACCTTCGCGATTTCTCCCGAGTCATACAAGGTGTTTGTTTGTCAA
GA
CCAGAAACAGCAGAAAACAAAGAGGCCATTAAACGCCTGTGGGTTCATGAGGTCCTCAGAGTCTATTA
T
GATCGCCTTGTGGATAATGCTGACAGAAGCTGGCTTATTAACTACATACAAGAAATTCTGAAAAATTAC
ATG
CAGGAAGATTTTCATGACCTATTTAAAAACTTGGATTTTAATCATGATGGCACTGTAGAAGAAGATG
AT
TTAAGAAGTTTAATGTTTTGTGATTTCCATGATCCTAAGAGGGAAGATTTTGGCTACAGAGAAATTGC
A
AATGTGGATGCTCTCAGGATGATTGTTGAAGGCCATCTAGATGAATATAACAACATGAGCAAAAAGCCC
ATG
AACCTCGTCTTGTTCCGATTTGCCATAGAACACATAAGCAGAATTTCTCGAATCTTGAAGCAGCCAC
GG
AGCCACGCCCTTCTGGTGGGGGTGGGCGGGAGCGGAAGGCAGTCAGTCACCAGACTTGCTGCGCACAT
G
GCTGATTATTCACTTTTCCAGGTGGAAATCTCCAAGGGCTATGGTAGCCATGAGTGGCATGAAGATCTG
AAA
GTGATCTTAAGAAAATGCGCAGAGAGTGACATGCAGGGTGTCTTCCTGTTCACAGATACACAAATAA
AA
AGAGAGTCGTTTCTAGAAGATGTCAACAATCTCCTAAACGCCGGGGAGGTTCCAAACCTCTTTGCTTT
A
GATGAGAAGCAAGAAATATGTGAAAAGATGCGTCAGATAGATCGCCAGCGGGATAAAAGCAAACAGACA
GAT
GGGAGCCCCATAGCTCTTTTCAACATGTTTATTGACTGCTGCCGCAACCAGCTGCATGTGGTCCTGG
CC
ATGAGTCCCATTGGAGACGCATTTCGGATTCGTCTTCGGAAATTCCCTGCTCTTGTTAACTGCTGTAC
C
ATTGACTGGTTTCAGTCATGGCCAGAAGATGCTCTGGAAGCGGTTGCTTCTCGGTTCCTGGAAGACATT
GAG
ATGTCAGAGGAAATCCGAGAAGGCTGTATTGACATGTGTAAAAGGTTCCACACTTCTACTATCAACT
TA
TCAACATCCTTCCACAATGAACTTCAAAGATATAATTACGTGACTCCCACCTCCTACCTGGAATTGAT
C
TCTACCTTCAAACTGTTGTTAGAAAAGAAAAGAAATGAAGTGATGAAAATGAAAAGGAGATACGAGGTG
GGT
TTGGATAAGCTGGACTCGGCATCATCCCAGGTGGCAACCATGCAGAGTGAGCTGGAGGCGCTGCATC
CG
CAGTTAAAAGTTGCCAGTAGAGAGGTTGACGAAATGATGATAATAATTGAGAGAGAGTCAATGGAGGT
G
GCCAAAACTGAGAAAATCGTGAAAGCTGATGAAACAGTAGCGAACGATCAAGCCATGGCAGCCAAAGCC
ATC
AAAGATGAATGCGATGCCGACTTGGCTGGAGCCCTACCCATCCTGGAGTCTGCACTGGCTGCCCTTG
AT
ACCCTGACCGCGCAGGATATCACTGTTGTGAAGTCCATGAAGAGTCCCCCTGCTGGCGTCAAACTTGT
C
ATGGAGGCTGTTTGCATATTGAAAGGGATCAAAGCTGACAAAATCCCTGACCCAACAGGTTCAGGGAAG
AAA
ACTGAGGATTTCTGGGGCCCTGCTAAGAGACTTCTCGGTGACATAAGGTTTCTGCAGTCACTTCATG
AG
TACGACAAGGACAATATTCCTCCTGCTTATATGAATATCATAAGGAAGAGTTATATCCCCAACCCAGA
C
TTTGTTCCAGAGAAGATCCGGAATGCTTCAACAGCTGCTGAGGGTCTGTGTAAGTGGGTCATCGCAATG
GAC
TCCTATGACAAAGTGGCAAAAATTGTAGCTCCCAAAAAGATAAAGCTGGCTGCAGCCGAAGGGAAGC
TG
AAGGTTGCTATGGAAGGCCTTAGAAAGAAGCAAGCTGCCCTGCATGAGGTTCAGGACAAGTTGGCCAA
A
CTCCAAGACACACTTGAGTTGAATAAGCAGAAGAAAGCAGACTTGGAACACCAGGTTGACTTGTGCAGC
AAA
AAGCTAGAACGCGCAGAGCAGCTGATCGGGGGCCTGGGAGGTGAGAAAACCCGATGGAGCAACTCCG
CG
CTGGAGCTTGGGCATCTGTACATCAACCTGACGGGAGATATCCTCATCTCCTCAGGGGTTGTCGCCTA
C
CTGGGAGCCTTTACATCTAACTACAGACAGAATCAAACCAAGCAGTGGTCACAGTCATGTAAAGAAAGA
GAC
ATCCCCTGCTCCGATGACTACTCTCTTATGGGTACACTGGGAGAAGCCGTGACGATTCGAGCTTGGA
AT
ATCGCTGGGTTACCCTCTGACTCTTTCTCCATTGATAATGGGATCATTATAATGAATGCAAGAAGGTG
G
CCTCTGATGATAGACCCTCAAGGTCAGGCTAATAAGTGGATCAAGAACATGGAGAAAACCAATAGCCTT
CAG
CTCATCAAACTAAGTGACCCTTCCTATGTCAGGACTCTGGAAAACTGTATCCAGTTTGGAACTCCTG
TG
TTGCTAGAAAATGTGGGAGAAGAACTGGACCCAATTCTAGAGCCTCTTTTGTTGAAGCAGACCTTCAA
G
CAGGGTGGGAGCACATGCATTCGGCTTGGAGACTCCACAATTGAGTATTCTCCTGACTTTCGCTTCTAC
ATC
ACGACCAAGCTGAGGAACCCGCACTATCTCCCAGAGACGTCAGTGAAGGTGACCTTGTTAAACTTCA
TG
ATAACTCCTGAGGGAATGCAGGATCAGCTTTTGGGAATCGTAGTGGCACGGGAAAGGCCAGACCTCGA
A
GAAGAAAAGCAAGCCTTGATACTACAAGGAGCTGACAATAAAAGGCAGTTAAAGGAAATAGAAGACAAG
ATT
TTAGAAGTTCTCTCATTATCAGAAGGCAATATATTAGAAGATGAGACTGCGATTAAAATATTATCTT
CC
TCCAAGTCTTTGGCTAATGAGATTTCTCAGAAGCAGGAAGTGGCTGAGGAGACAGAGAAAAAGATTGA
C
ATTACCCGCATGGGCTATCGGCCCATTGCTATCCATTCTTCCATCCTGTTCTTCTCCATCGCTGATCTA
GCT
AACATCGAGCCCATGTACCAGTATTCTCTGACCTGGTTTATTAACCTGTTCATCCTGTCCATTGAAA
AT
TCGGAGAAATCAGACATCTTATCAAAAAGGCTTCAGATCCTCAGAGATCACTTCACCTACTCACTCTA
T
GTCAACATCTGCCGCTCCCTCTTTGAAAAGGACAAGCTGCTGTTTTCCTTTTGTCTCACTGTGAATCTG
CTG
ATACATGACAATGCGATTAACAAAACAGAGTGGAGATTTCTACTCACTGGTGGCATTGGGCTGGATA
AT
CCTTATACCAATCCTTGCACATGGCTTCCTCAAAAATCCTGGGATGAGATTTGTCGACTAGATGACTT
A
CCTGCCTTTAAGACCATTCGAGAGGAGTTTATGCGCTTAAAGGATGGATGGAAAAAAGTATATGACAGT
ATG
GAGCCACACCATGAGATGTTTCCCGAAGATTGGGGAAATAAAGCAAACGACTTTCAGAGGATGCTTA
TT
ATCCGTTGCTTGAGGCCCGACAAGGTTATTCCGATGCTGCAGGAATTCATAATCAAGAAGTTGGGGCG
C
TCTTTCATTGAGCCACCCCCCTTTGACTTGGCCAAGGCATTTGGGGACAGTAACTGTTGTGCACCGTTG
ATC
TTTGTGCTCTCCCCTGGAGCAGATCCCATGAATGCTCTTCTGAAATTCGCTGATGACCAGGGATATG
GG
GGCTCAAAACTTAGCTCTCTATCTCTGGGCCAAGGCCAAGGGCCCATTGCTATGAAGATGTTAGAGAA
A
GCTGTCAAGGATGGGACCTGGGTTGTTCTTCAAAACTGTCACCTTGCCACTTCTTGGATGCCAACTCTT
GAG
AAAGTTTGTGAGGAGTTAAGCGCAGAATCAACACACCCTGATTTCCGAATCTGGCTGACGAGTTACC
CA
TCTCCAAATTTCCCCGTGTCAGTCCTGCAGAATGGAGTAAAAATGACCAACGAAGCACCAAAAGGATT
G
CGGGCTAATATCATCCGATCATACCTCATGGACCCCATCTCTGACCCTGAATTCTTTGGCAGCTGCAAA
AAG
CCTGAGGAATTCAAGAAACTGCTTTATGGCCTCTGTTTCTTTCATGCTTTGGTACAAGAGAGACGAA
AA
TTCGGACCCCTTGGGTGGAATATTCCTTACGAATTCAATGAGACAGATCTAAGAATCAGTGTGCAGCA
A
CTCCACATGTTCCTGGACCAGTATGAGGAACTTCCTTACGATGCTCTCCGCTACATGACTGGGGAATGT
AAT
TATGGAGGCCGGGTGACAGACGACTGGGATCGGCGCACACTGCGCAGCATTCTCAACAAATTCTTCT
GC
ACAGAATTAGTTGAAAATCCACAATACAAATTTGACTCTAGTGGCATCTATTTTGTTCCTCCCTCTGG
T
GATCACAAAAGCTACATCGACTACACAAAGACTCTGCCACTGATCCCAGCACCAGAAGTCTTTGGGATG
AAT
GCCAACGCTGACATCACTAAGGACCAGTCGGAGACGCAGCTGCTGTTTGATAACATTCTCCTTACCC
AG
TCTCATTCATCAGGTTCTGGAACAAAGTCATCAGATGAAGTAGTAAATGAGGTTGCTGGAGATATCCT
G
GGTAAACTTCCAAACAACTTTGATGTGGAGGCTGCCATGAGGAGATACCCAACAACCTACACTCAGAGC
ATG
AACACTGTCCTTGTCCAAGAGATGGGACGTTTCAATAAGTTGCTGATAACCATAAGAGAATCATGCA
TT
AATATTCAAAAAGCAGTCAAGGGACTTGTCGTGATGTCTACAGAGCTGGAGGAAGTGGTGAGCAGCAT
C
CTGAATGTCAAAATCCCAGCAATGTGGATGGGTAAATCCTACCCCAGCCTGAAGCCACTTGGCAGCTAT
GTG
AATGACTTCCTTGAGAGACTAAAATTCCTGCAGCAATGGTATGAGGTTGGTCCCCCTCCAGTCTTCT
GG
CTTTCTGGCTTCTTCTTCACACAAGCCTTCCTGACTGGTGCGCAGCAGAACTATGCGAGAAAATTCAC
A
ATTCCAATTGATCTTCTTGGGTTTGACTATGAAGTGATGGATGACAAGGAATATAAAAAGGCTCCAGAG
GAT
GGTGTTTACATTCATGGATTGTTTTTGGATGGAGCTTCCTGGGACAGGAAGACCAAGAAACTTGCAG
AA
TCACATCCTAAAGTTCTGTATGACACAGTCCCCGTGATGTGGCTAAAGCCATGCAAAAAGTCAGACAT
A
CCCAGACGACCAAGTTACGTTGCTCCACTGTATAAGACAAGCGAGAGGAGGGGCACACTCTCCACCACT
GGC
CACTCCACAAATTTCGTGATTGCCATGATTCTTCCCTCTGTCCACCCCAAGGAACACTGGATTGGAC
GG
GGTGTGGCACTGCTGTGTCAACTAAACTCATAA


Translation (4024 aa):
MSSKKDKLSTKGKSKTPVRFLPQLPMDKLSSKEKVKLPTTVLPQLSLTGVKPQWQQTAPSFHLNIKQENP
V
LEPYTVKNEQSF
AEYMEHCQKKGKLLDQIDDDRSAPSTSRSKIKSPQKERENLRSTLAKVIMQKDGGLE
S
DVIDESGIPKETTSATEKDIS
RYYYYIRQGLDTDHVAPMEDSWLEHVLQLVPEHLKVLTNSIKVLSDEI
R
EDYLLSVKKSI
VDFVLKDPREKDDDGKITELPPHRAEMEVLPKPWRRSFLSACSYIRDHLNAMNPMMLA
V
LDLWHSTF
KKLRLVDIEEFHSCQDALELSEFQNIVIKHMESAKETLLKTWFPEVQNIFNQGNKKKQLPT
G
KSTAKLDSFFNCAATLMTLQLQDLILVSMQDFTDLIAQPL
ESIRVFEHPGFIMRLVLDKEAIKFEPEFN
E
YIDSLINIYEIMIKAVSFVPRVETKLYSQW
ESKSKPTTLKPIILNEIIDTHKEKIREVILRESVAPTEH
L
KMYDKYQFLITGKAERDIDELLFQNQNYERLIEEIRKYQKLGEEIQYTSQK
TVCLGMFEMHCEELIRSL
V
KRADVICGKLIAKMFRDHQEVNT
MLCDEFEKIAEKALSTPLNTAELMEMKAHVQKLETTDMLELGQRLV
D
SKICLAFLIECVNFSPADIRLNKSVFQWYGRMGEIFDEHRKIIKEKTELYQEFLK
FRCERFVEELESYA
K
QVEEFHAFGDLLDVQRYLQKAQVLNGKLDAAADK
IDQFNAEEEAFGWVPSAYPQRKKIQDALNPYLHLY
E
TAVEFSTKHRGWTEGPYHKVNPDQVEADVGNYWRGLYKLEKVFHDSPNALAMTKKVHSMVEEFKQYIPL
I
QVFCNPGLRPRHWEAMSTIVGYPLQPSDDSTVFSFIDMNLEPFLDRFGSISEAASKEYSLEKAMDKMMT
E
WDSMEFVILPYRESGTYILSSVDDIQMLLDDHIIKTQTMRGSPFIKPYEKQM
REWEGKLLLLQEILDEW
L
KVQATWLYLEPIFSSRDIMSQMPEEGRRFTAVDKTWRDVMKTVVQ
DKQVLAVVTIERMLERLKKSNELL
E
LILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPT
RVQPHLKKCFEGIAKVEFTETLDITHMKSS
E
GEVVELVDTISTAKARGQVEKWLVELERTMIKSIHK
VIRDAIVAYTKTSRISWVRDWPGQTVLCVSQTF
W
TVEVQIAIPEGHR
ALEGYLAKCNHQIDDIVTLVRGKLSKQNRVTLGALVVLDVHARDVLASLVDKKISD
D
SDFQWLSQLRYYWQ
ENNLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPA
G
TGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFK
GLLSCGAWACFDEFNRIDLEVLSVVAQQILTI
Q
R
GINAGTDLLVFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCG
F
VTARPLSIKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLK
LKYPNENEEILLLRSIIDVNLPKF
L
SHDLPLFE
GITSDLFPGVKLPKPDYNDLLAAIRDNCHSMNLQMTDFFSEKILQIYEMMIVRHGFMIVGE
P
FGGKTSAYRVLAGALNDICEK
GLMEENKVQITVLNPKSVTMGQLYGQFDLVSHEWSDGVLAVSFRAFAA
S
S
TPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMI
Y
MEPHMLGWRPLMVSWINTLPQSVSIIQKEFIEGLFDRMVPLSVEFIRRHTK
ELSPTSDTNLVRSLMNLI
D
CFMDDFADENKQKERNDRESFSLLE
GIFLFSLIWSVGATCTDDDRLKFDKILRELLEGPISNLTRNKFK
L
LSGTEQTSSKVFIVPFPEKGTIYDYQFIPE
GLGRWDKWIKDLADTPPIPKDVQFNEIIVPTLDTIRYSA
L
MNLLTTHQKPSIFVGPTGTGKSVYII
NFLLNQLNKDIYKPLIVNFSAQTTAAQTQNIIMSKLDKRRKGV
F
GPPLGKRM
IVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSVIKLVDIQIMCAMGPPGGGRN
P
ITPRYMRHFNIVTINEFSNKSMFTIFSRILAWHLRT
CYKFPDDFLDLTTQIVNGTMALYKDAMKNLLPT
P
AKSHYLFNLRDFSRVIQGVCLSRPETAENKEAIKRLWVHE
VLRVYYDRLVDNADRSWLINYIQEILKNY
M
QEDFHDLFKNLDFNHDGTVEEDDLRSLMFCDFHDPKREDFGYREIANVDALRMIVEGHLDEYNNMSKKP
M
NLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSLFQVEISKGYGSHEWHEDL
K
VILRKCAESDMQGVFLFTDTQIKRESFLEDVNNLLNAGEVPNLFALDEKQEICEKMRQIDRQRDKSKQT
D
GSPIALFNMFIDCCRNQLHVVLAMSPIGDAFRIRLRKFPALVNCCTIDWFQ
SWPEDALEAVASRFLEDI
E
MSEEIREGCIDMCKRFHTSTINLSTSFHNELQRYNYVTPTSYLELISTFKLLLEKKR
NEVMKMKRRYEV
G
LDKLDSASSQVATMQSELEALHPQLKVASREVDEMMIIIERESMEVAKTEKIVKADETVANDQAMAAKA
I
KDECDADLAGALPILESALAALDTLTAQ
DITVVKSMKSPPAGVKLVMEAVCILKGIKADKIPDPTGSGK
K
TEDFWGPAKRLLGDIRFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDFVPEKIRNASTAAEGLCKWVIAM
D
SYD
KVAKIVAPKKIKLAAAEGKLKVAMEGLRKKQAALHEVQDKLAKLQDTLELNKQKKADLEHQVDLCS
K
KLERAEQLIGGLGGEKTRWSNSALELGHLYINLTGDILISSGVVAYLGAFTSNYRQ
NQTKQWSQSCKER
D
IPCSDDYSLMGTLGEAVTIRAWNIAGLPSDSFSIDNGIII
MNARRWPLMIDPQGQANKWIKNMEKTNSL
Q
LIKLSDPSYVRTLENCIQFGTP
VLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYSPDFRFY
I
TTKLRNPHYLPETSVK
VTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALILQGADNKRQLKEIEDK
I
LEVLSLSEGNILEDETAIKILSSSKSLANEISQKQEVAEETEKKIDITRMGYRPIAIHSSILFFSIADL
A
NIEPMYQYSLTWFINLFILSIENSEKSDILSK
RLQILRDHFTYSLYVNICRSLFEKDKLLFSFCLTVNL
L
IHDNA
INKTEWRFLLTGGIGLDNPYTNPCTWLPQKSWDEICRLDDLPAFKTIREEFMRLKDGWKKVYDS
M
EPHHEMFPEDWGNKANDFQRMLIIRCLRPDKVIPMLQEFIIKKLGRSFIEPPPFDLAKAFGDSNCCAPL
I
FVLSPGADPMNALLKFADDQ
GYGGSKLSSLSLGQGQGPIAMKMLEKAVKDGTWVVLQNCHLATSWMPTL
E
KVCE
ELSAESTHPDFRIWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCK
K
P
EEFKKLLYGLCFFHALVQERRKFGPLGWN