NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS56483.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
56483.1 Public Homo sapiens 7 MATCAP2 24 110 108 CCDS HistoryNCBI Gene:23366Re-query CCDS DB by CCDS ID:56483.1Re-query CCDS DB by GeneID:23366See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 9, NCBI annotation release 37.3, Ensembl annotation release 64

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 56483.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000338533.9 ENSP00000344805.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000338533.9Link to Ensembl Protein Viewer:ENSP00000344805.5Re-query CCDS DB by Nucleotide ID:ENST00000338533Re-query CCDS DB by Protein ID:ENSP00000344805
Original member Current member NCBI NM_001199707.2 NP_001186636.1 Accepted alive Link to Nucleotide Sequence:NM_001199707.2Link to Protein Sequence:NP_001186636.1Re-query CCDS DB by Nucleotide ID:NM_001199707Re-query CCDS DB by Protein ID:NP_001186636Link to BLAST:NP_001186636.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001186636.1 507 Q8NCT3-2 507 100% 0 0

Chromosomal Locations for CCDS 56483.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 7 (NC_000007.14)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 36326760 36326918 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 36330982 36331079 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 36333856 36334161 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 36335046 36335178 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 36356902 36357590 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 36366704 36366842 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1524 nt):
ATGGTAGCCACCGGCTGGGCGCGCCGCTCGGGACTCCACCCTGCGCCCCGACCCCTTCGGGGCGCGCAGG
AG
GCGCTCGCGAAAAACCTGTGGAGGGAAGAGAGAAATCGGCCCCTTATCCTTTCGTCACTTATTATCAA
A
AAGCTTCACTGGCCTGAGCAAGAACTTGCTAAGAAGTCTATTCTAAATGCAGAAGATTCATTGATCATT
GAC
AACAAAAGAAGCATTTCACATTTGTCCTCGGGAGTGCTAAAAGACATTTTCACAACTGGAACCAGTA
GT
TACAATGTCCTACTACAGAGCAAGGAGGAAAAAAAGTATCATTCACAAAAACAGTCTTCCTCCACCTA
C
TCCAAAAGATGTAGAAAACCCAGCAAATCTCCTAACACTTCTCGTAGCAAAGATCCTCGCAGGATGAAA
GCC
CTGGTGCCTGTGACAAGCAGTGGTACTTGGTACTGCCTGGAGAGGCGGCCTGCTGTTTTTGTCACTA
GT
TCAGTGTCAAGTCCTGTAAAGTTTACACATGATATCTCTGTTACAGGGAATGGCATAGTACTGCCACC
T
AAACCCAAAAGCAAGGTCAAGTGGTGCCATTTCTCCACTCTTCCAAAGCCAAAGCCTCAGCTGTCTAGA
AGC
TTTGAAAAGGGAGATGACTTTTCTGGGAAGAAATTTTGTATATTGACTGCTATAAAACCCACCAACT
TA
GAGAAAGAAAAACTGAGATTCTTCAAATCTGACTATACCTACAATCCTCAGTTTGAGTATGCCAATCC
T
GCTCTGCCAAGCGTATTAGCTAAGCATAGCCACGCATCTGACCGATTTCTTAAGCAGATTGTAGTTCAT
CTC
ACTGAGGACCTGCTTTCCCGAGCGTCAATGACAGTAGTAAATGGATGTCCGACTCTGACTATCAATG
TG
TCCACTGCACGTGAGCATTGGCTGGAGGGAATGCTGAGGCATGAAATAGGTACACATTATTTTCGAGG
T
ATTAACAACCTCCAGCAGCCATGGAACAGTTGGACTGGACGTAAAAAACATGAGCTAAAGCCAAATAAT
CCC
ACAGAGGAAGGACTAGCAAGCATTCACAGTGTTCTGTTTAGAAAAGACCCTTTTTTATGGAGGGCTG
CC
CTCCTCTACTACACTGTTTATCAAGCCAGCCAAATGTCTTTTTGTGAACTCTTTAAAGATATTGGCAG
G
TTTGTCAAGGACCCCAATACAAGATGGGATTATTGTGTACGGGCCAAGAGGGGATGGACTGATACTTCC
CAA
CCAGGGTGTTTTAGTAAAGACCAGGTATACTTGGATGGAATTCTTCAAATCCTCCGATACAGAGATA
CC
ATAGACTTCCATCTGCTGACTGCTCTCGGGAAGGTTTCTTATGAAGATGTGGATCGCTTAAAAGGATT
G
GCAGTTACCGAAAACATGAGGGTCCCTCATTTCCTGCAGGACCATGGCCGATATATGGAACACTTAGAG
AAG
ATCATGGAAGTGAATGAACTGACTGACAGGGAACTGAAAGATCTTATATAG


Translation (507 aa):
MVATGWARRSGLHPAPRPLRGAQEALAKNLWREERNRPLILSSLIIKKLHWPEQELAKKSILNAEDSLII
D
NKRSISHLSSGVLKDIFTTGTSSYNVLLQSKEEKKYHSQKQSSSTYSKRCRKPSKSPNTSRSKDPRRMK
A
LVPVTSSGTWYCLERRPAVFVTSSVSSPVKFTHDISVTGNGIVLPPKPKSKVKWCHFSTLPKPKPQLSR
S
FEKGDDFSGKKFCILTAIKPTNLEKEKLRFFKSDYTYNPQFEYANPALPSVLAKHSHASDRFLKQ
IVVH
L
TEDLLSRASMTVVNGCPTLTINVSTAREHWLEGMLRHEI
GTHYFRGINNLQQPWNSWTGRKKHELKPNN
P
TEEGLASIHSVLFRKDPFLWRAALLYYTVYQASQMSFCELFKDIGRFVKDPNTRWDYCVRAKRGWTDTS
Q
P
GCFSKDQVYLDGILQILRYRDTIDFHLLTALGKVSYEDVDRLKGLAVTENMRVPHFLQDHGRYMEHLE
K
IMEVNELTDRELKDLI




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser