NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS56482.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
56482.1 Public Homo sapiens 7 MATCAP2 24 110 108 CCDS HistoryNCBI Gene:23366Re-query CCDS DB by CCDS ID:56482.1Re-query CCDS DB by GeneID:23366See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 9, NCBI annotation release 37.3, Ensembl annotation release 64

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 56482.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000436884.5 ENSP00000389985.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000436884.5Link to Ensembl Protein Viewer:ENSP00000389985.1Re-query CCDS DB by Nucleotide ID:ENST00000436884Re-query CCDS DB by Protein ID:ENSP00000389985
Original member Current member NCBI NM_001199708.2 NP_001186637.1 Accepted alive Link to Nucleotide Sequence:NM_001199708.2Link to Protein Sequence:NP_001186637.1Re-query CCDS DB by Nucleotide ID:NM_001199708Re-query CCDS DB by Protein ID:NP_001186637Link to BLAST:NP_001186637.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001186637.1 417 Q8NCT3-5 417 100% 0 0

Chromosomal Locations for CCDS 56482.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 7 (NC_000007.14)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 36326760 36326918 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 36330982 36331079 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 36333856 36334161 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 36335046 36335178 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 36336154 36336297 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 36356902 36357315 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1254 nt):
ATGAAAGCCCTGGTGCCTGTGACAAGCAGTGGTACTTGGTACTGCCTGGAGAGGCGGCCTGCTGTTTTTG
TC
ACTAGTTCAGTGTCAAGTCCTGTAAAGTTTACACATGATATCTCTGTTACAGGGAATGGCATAGTACT
G
CCACCTAAACCCAAAAGCAAGGTCAAGTGGTGCCATTTCTCCACTCTTCCAAAGCCAAAGCCTCAGCTG
TCT
AGAAGCTTTGAAAAGGGAGATGACTTTTCTGGGAAGAAATTTTGTATATTGACTGCTATAAAACCCA
CC
AACTTAGAGAAAGAAAAACTGAGATTCTTCAAATCTGACTATACCTACAATCCTCAGTTTGAGTATGC
C
AATCCTGCTCTGCCAAGCGTATTAGCTAAGCATAGCCACGCATCTGACCGATTTCTTAAGCAGTCTATC
AAT
ATTATGGAACTGACTTTACAGAAATATGGAAGTTATGAAAAATTTGAACAAGCCACTGGTGGTAGCT
TG
CTCTCTAAAACTCGAATCTGGAGTCACGTTAGGAAGTACATGATGAAGGAAGGCTGCCTAGGGGAGAT
T
GTAGTTCATCTCACTGAGGACCTGCTTTCCCGAGCGTCAATGACAGTAGTAAATGGATGTCCGACTCTG
ACT
ATCAATGTGTCCACTGCACGTGAGCATTGGCTGGAGGGAATGCTGAGGCATGAAATAGGTACACATT
AT
TTTCGAGGTATTAACAACCTCCAGCAGCCATGGAACAGTTGGACTGGACGTAAAAAACATGAGCTAAA
G
CCAAATAATCCCACAGAGGAAGGACTAGCAAGCATTCACAGTGTTCTGTTTAGAAAAGACCCTTTTTTA
TGG
AGGGCTGCCCTCCTCTACTACACTGTTTATCAAGCCAGCCAAATGTCTTTTTGTGAACTCTTTAAAG
AT
ATTGGCAGGTTTGTCAAGGACCCCAATACAAGATGGGATTATTGTGTACGGGCCAAGAGGGGATGGAC
T
GATACTTCCCAACCAGGGTGTTTTAGTAAAGACCAGGTATACTTGGATGGAATTCTTCAAATCCTCCGA
TAC
AGAGATACCATAGACTTCCATCTGCTGACTGCTCTCGGGAAGGTTTCTTATGAAGATGTGGATCGCT
TA
AAAGGATTGGCAGTTACCGAAAACATGAGGGTCCCTCATTTCCTGCAGGACCATGGCCGATATATGGA
A
CACTTAGAGAAGATCATGGAAGTGAATGAACTGACTGACAGGGAACTGAAAGATCTTATATAG


Translation (417 aa):
MKALVPVTSSGTWYCLERRPAVFVTSSVSSPVKFTHDISVTGNGIVLPPKPKSKVKWCHFSTLPKPKPQL
S
RSFEKGDDFSGKKFCILTAIKPTNLEKEKLRFFKSDYTYNPQFEYANPALPSVLAKHSHASDRFLKQ
SI
N
IMELTLQKYGSYEKFEQATGGSLLSKTRIWSHVRKYMMKEGCLGE
IVVHLTEDLLSRASMTVVNGCPTL
T
INVSTAREHWLEGMLRHEI
GTHYFRGINNLQQPWNSWTGRKKHELKPNNPTEEGLASIHSVLFRKDPFL
W
RAALLYYTVYQASQMSFCELFKDIGRFVKDPNTRWDYCVRAKRGWTDTSQP
GCFSKDQVYLDGILQILR
Y
RDTIDFHLLTALGK
VSYEDVDRLKGLAVTENMRVPHFLQDHGRYMEHLEKIMEVNELTDRELKDLI



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser