NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS56379.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
56379.1 Public Homo sapiens 5 HSD17B4 22 109 92 CCDS HistoryNCBI Gene:3295Re-query CCDS DB by CCDS ID:56379.1Re-query CCDS DB by GeneID:3295See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 9, NCBI annotation release 37.3, Ensembl annotation release 64

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 56379.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000414835.7 ENSP00000411960.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000414835.7Link to Ensembl Protein Viewer:ENSP00000411960.3Re-query CCDS DB by Nucleotide ID:ENST00000414835Re-query CCDS DB by Protein ID:ENSP00000411960
Original member Current member EBI ENST00000504811.6 ENSP00000420914.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000504811.6Link to Ensembl Protein Viewer:ENSP00000420914.1Re-query CCDS DB by Nucleotide ID:ENST00000504811Re-query CCDS DB by Protein ID:ENSP00000420914
Original member NCBI NM_001199291.2 NP_001186220.1 Updated not alive Link to Nucleotide Sequence:NM_001199291.2Link to Protein Sequence:NP_001186220.1Re-query CCDS DB by Nucleotide ID:NM_001199291Re-query CCDS DB by Protein ID:NP_001186220
Current member NCBI NM_001199291.3 NP_001186220.1 Accepted alive Link to Nucleotide Sequence:NM_001199291.3Link to Protein Sequence:NP_001186220.1Re-query CCDS DB by Nucleotide ID:NM_001199291Re-query CCDS DB by Protein ID:NP_001186220Link to BLAST:NP_001186220.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001186220.1 761 P51659-2 761 100% 0 0

Chromosomal Locations for CCDS 56379.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 119452754 119452821 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119456315 119456368 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119471636 119471700 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119473908 119474015 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119474401 119474460 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119475706 119475727 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119475824 119475870 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119477417 119477501 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119478834 119479021 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119489192 119489283 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119492100 119492124 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119493818 119493946 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119496543 119496646 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119499317 119499553 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119502041 119502092 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119506818 119506889 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119509141 119509244 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119514981 119515046 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119525216 119525285 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119525917 119526023 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119527133 119527219 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119529894 119529980 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119531266 119531404 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119536423 119536550 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119541905 119541994 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2286 nt):
ATGGTTATTCTTGAGGCACCGCATCTCTTGAGGAGGAAAGAGCCGGAAACACCTGGTCTCTCAAGCAGGA
TT
GGGCCGAGCCTATGCCCTGGCTTTTGCAGAAAGAGGAGCGTTAGTTGTTGCTTTCAAAATCTATGCAA
T
AACCCTATGGAGAAGATCATTTCACAATGCAGATTCTTTGTTTCAATGAATGATTTGGGAGGGGACTTC
AAA
GGAGTTGGTAAAGGCTCCTTAGCTGCTGATAAGGTTGTTGAAGAAATAAGAAGGAGAGGTGGAAAAG
CA
GTGGCCAACTATGATTCAGTGGAAGAAGGAGAGAAGGTTGTGAAGACAGCCCTGGATGCTTTTGGAAG
A
ATAGATGTTGTGGTCAACAATGCTGGAATTCTGAGGGATCGTTCCTTTGCTAGGATAAGTGATGAAGAC
TGG
GATATAATCCACAGAGTTCATTTGCGGGGTTCATTCCAAGTGACACGGGCAGCATGGGAACACATGA
AG
AAACAGAAGTATGGAAGGATTATTATGACTTCATCAGCTTCAGGAATATATGGCAACTTTGGCCAGGC
C
AATTATAGTGCTGCAAAGTTGGGTCTTCTGGGCCTTGCAAATTCTCTTGCAATTGAAGGCAGGAAAAGC
AAC
ATTCATTGTAACACCATTGCTCCTAATGCGGGATCACGGATGACTCAGACAGTTATGCCTGAAGATC
TT
GTGGAAGCCCTGAAGCCAGAGTATGTGGCACCTCTTGTCCTTTGGCTTTGTCACGAGAGTTGTGAGGA
G
AATGGTGGCTTGTTTGAGGTTGGAGCAGGATGGATTGGAAAATTACGCTGGGAGCGGACTCTTGGAGCT
ATT
GTAAGACAAAAGAATCACCCAATGACTCCTGAGGCAGTCAAGGCTAACTGGAAGAAGATCTGTGACT
TT
GAGAATGCCAGCAAGCCTCAGAGTATCCAAGAATCAACTGGCAGTATAATTGAAGTTCTGAGTAAAAT
A
GATTCAGAAGGAGGAGTTTCAGCAAATCATACTAGTCGTGCAACGTCTACAGCAACATCAGGATTTGCT
GGA
GCTATTGGCCAGAAACTCCCTCCATTTTCTTATGCTTATACGGAACTGGAAGCTATTATGTATGCCC
TT
GGAGTGGGAGCGTCAATCAAGGATCCAAAAGATTTGAAATTTATTTATGAAGGAAGTTCTGATTTCTC
C
TGTTTGCCCACCTTCGGAGTTATCATAGGTCAGAAATCTATGATGGGTGGAGGATTAGCAGAAATTCCT
GGA
CTTTCAATCAACTTTGCAAAGGTTCTTCATGGAGAGCAGTACTTAGAGTTATATAAACCACTTCCCA
GA
GCAGGAAAATTAAAATGTGAAGCAGTTGTTGCTGATGTCCTAGATAAAGGATCCGGTGTAGTGATTAT
T
ATGGATGTCTATTCTTATTCTGAGAAGGAACTTATATGCCACAATCAGTTCTCTCTCTTTCTTGTTGGC
TCT
GGAGGCTTTGGTGGAAAACGGACATCAGACAAAGTCAAGGTAGCTGTAGCCATACCTAATAGACCTC
CT
GATGCTGTACTTACAGATACCACCTCTCTTAATCAGGCTGCTTTGTACCGCCTCAGTGGAGACTGGAA
T
CCCTTACACATTGATCCTAACTTTGCTAGTCTAGCAGGTTTTGACAAGCCCATATTACATGGATTATGT
ACA
TTTGGATTTTCTGCCAGGCGTGTGTTACAGCAGTTTGCAGATAATGATGTGTCAAGATTCAAGGCAA
TT
AAGGCTCGTTTTGCAAAACCAGTATATCCAGGACAAACTCTACAAACTGAGATGTGGAAGGAAGGAAA
C
AGAATTCATTTTCAAACCAAGGTCCAAGAAACTGGAGACATTGTCATTTCAAATGCATATGTGGATCTT
GCA
CCAACATCTGGTACTTCAGCTAAGACACCCTCTGAGGGCGGGAAGCTTCAGAGTACCTTTGTATTTG
AG
GAAATAGGACGCCGCCTAAAGGATATTGGGCCTGAGGTGGTGAAGAAAGTAAATGCTGTATTTGAGTG
G
CATATAACCAAAGGCGGAAATATTGGGGCTAAGTGGACTATTGACCTGAAAAGTGGTTCTGGAAAAGTG
TAC
CAAGGCCCTGCAAAAGGTGCTGCTGATACAACAATCATACTTTCAGATGAAGATTTCATGGAGGTGG
TC
CTGGGCAAGCTTGACCCTCAGAAGGCATTCTTTAGTGGCAGGCTGAAGGCCAGAGGGAACATCATGCT
G
AGCCAGAAACTTCAGATGATTCTTAAAGACTACGCCAAGCTCTGA


Translation (761 aa):
MVILEAPHLLRRKEPETPGLSSRIGPSLCPGFCRKRSVSCCFQNLCNNPMEKIISQCRFFVSMNDLGGDF
K
GVGKGSLAADKVVEEIRRRGGKAVANY
DSVEEGEKVVKTALDAFGRIDVVVNNAGILRDRSFARISDED
W
DIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKS
N
IHCNTIAPNAGSRMTQTVMPE
DLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGA
I
VRQKNHPMTPEAVKANWKKICDFENASKPQSIQ
ESTGSIIEVLSKIDSEGGVSANHTSRATSTATSGFA
G
AIGQKLPPFSYAYTELEAIMYALGVGASIKDPKDLKFIYEGSSDFSCLPTFGVIIGQKSMMGGGLAEIP
G
LSINFAK
VLHGEQYLELYKPLPRAGKLKCEAVVADVLDKGSGVVIIMDVYSYSEKELICHNQFSLFLVG
S
GGFGGKRTSDKVK
VAVAIPNRPPDAVLTDTTSLNQAALYRLSGDWNPLHIDPNFASLAGFDKPILHGLC
T
FGFSARRVLQQFADNDVSRFKAIK
ARFAKPVYPGQTLQTEMWKEGNRIHFQTKVQETGDIVISNAYVDL
A
PTSGTSAKTPSE
GGKLQSTFVFEEIGRRLKDIGPEVVKKVNAVFEWHITKGGNIGAKWTIDLKSGSGKV
Y
QGPAKGAADTTIILSDEDFMEVVLGKLDPQK
AFFSGRLKARGNIMLSQKLQMILKDYAKL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser