NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS56278.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
56278.1 Public Homo sapiens 3 ATP2C1 22 109 92 CCDS HistoryNCBI Gene:27032Re-query CCDS DB by CCDS ID:56278.1Re-query CCDS DB by GeneID:27032See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 9, NCBI annotation release 37.3, Ensembl annotation release 64

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 56278.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000507488.6 ENSP00000421326.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000507488.6Link to Ensembl Protein Viewer:ENSP00000421326.3Re-query CCDS DB by Nucleotide ID:ENST00000507488Re-query CCDS DB by Protein ID:ENSP00000421326
Original member Current member NCBI NM_001199180.1 NP_001186109.1 Accepted alive Link to Nucleotide Sequence:NM_001199180.1Link to Protein Sequence:NP_001186109.1Re-query CCDS DB by Nucleotide ID:NM_001199180Re-query CCDS DB by Protein ID:NP_001186109Link to BLAST:NP_001186109.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001186109.1 973 P98194-7 973 100% 0 0

Chromosomal Locations for CCDS 56278.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 3 (NC_000003.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 130850821 130850928 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 130930416 130930526 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 130932022 130932138 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 130934622 130934711 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 130937428 130937463 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 130940630 130940691 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 130941591 130941699 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 130953821 130953976 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 130955012 130955080 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 130956104 130956179 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 130959275 130959341 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 130963971 130964095 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 130964948 130965045 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 130967145 130967240 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 130967330 130967419 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 130969292 130969396 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 130975332 130975488 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 130979249 130979419 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 130980582 130980679 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 130992951 130993001 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 130993932 130994098 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 130996043 130996111 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 130996680 130996796 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 130997606 130997753 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 130998294 130998389 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 130999518 130999659 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 131001220 131001314 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 131016152 131016247 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2922 nt):
ATGGATAGTCTGTTGCCTCCATCTAGATTCTCTTATTTCAAAAAATATCCTCTCCATGCAATTAGGAGAT
AT
TTATCGACGCTGAGAAACCAAAGAGCCGAAGAACAGGTTGCACGTTTTCAAAAAATACCTAATGGTGA
A
AATGAGACAATGATTCCTGTATTGACATCAAAAAAAGCAAGTGAATTACCAGTCAGTGAAGTTGCAAGC
ATT
CTCCAAGCTGATCTTCAGAATGGTCTAAACAAATGTGAAGTTAGTCATAGGCGAGCCTTTCATGGCT
GG
AATGAGTTTGATATTAGTGAAGATGAGCCACTGTGGAAGAAGTATATTTCTCAGTTTAAAAATCCCCT
T
ATTATGCTGCTTCTGGCTTCTGCAGTCATCAGTGTTTTAATGCATCAGTTTGATGATGCCGTCAGTATC
ACT
GTGGCAATACTTATCGTTGTTACAGTTGCCTTTGTTCAGGAATATCGTTCAGAAAAATCTCTTGAAG
AA
TTGAGTAAACTTGTGCCACCAGAATGCCATTGTGTGCGTGAAGGAAAATTGGAGCATACACTTGCCCG
A
GACTTGGTTCCAGGTGATACAGTTTGCCTTTCTGTTGGGGATAGAGTTCCTGCTGACTTACGCTTGTTT
GAG
GCTGTGGATCTTTCCATTGATGAGTCCAGCTTGACAGGTGAGACAACGCCTTGTTCTAAGGTGACAG
CT
CCTCAGCCAGCTGCAACTAATGGAGATCTTGCATCGAGAAGTAACATTGCCTTTATGGGAACACTGGT
C
AGATGTGGCAAAGCAAAGGGTGTTGTCATTGGAACAGGAGAAAATTCTGAATTTGGGGAGGTTTTTAAA
ATG
ATGCAAGCAGAAGAGGCACCAAAAACCCCTCTGCAGAAGAGCATGGACCTCTTAGGAAAACAACTTT
CC
TTTTACTCCTTTGGTATAATAGGAATCATCATGTTGGTTGGCTGGTTACTGGGAAAAGATATCCTGGA
A
ATGTTTACTATTAGTGTAAGTTTGGCTGTAGCAGCAATTCCTGAAGGTCTCCCCATTGTGGTCACAGTG
ACG
CTAGCTCTTGGTGTTATGAGAATGGTGAAGAAAAGGGCCATTGTGAAAAAGCTGCCTATTGTTGAAA
CT
CTGGGCTGCTGTAATGTGATTTGTTCAGATAAAACTGGAACACTGACGAAGAATGAAATGACTGTTAC
T
CACATATTTACTTCAGATGGTCTGCATGCTGAGGTTACTGGAGTTGGCTATAATCAATTTGGGGAAGTG
ATT
GTTGATGGTGATGTTGTTCATGGATTCTATAACCCAGCTGTTAGCAGAATTGTTGAGGCGGGCTGTG
TG
TGCAATGATGCTGTAATTAGAAACAATACTCTAATGGGGAAGCCAACAGAAGGGGCCTTAATTGCTCT
T
GCAATGAAGATGGGTCTTGATGGACTTCAACAAGACTACATCAGAAAAGCTGAATACCCTTTTAGCTCT
GAG
CAAAAGTGGATGGCTGTTAAGTGTGTACACCGAACACAGCAGGACAGACCAGAGATTTGTTTTATGA
AA
GGTGCTTACGAACAAGTAATTAAGTACTGTACTACATACCAGAGCAAAGGGCAGACCTTGACACTTAC
T
CAGCAGCAGAGAGATGTGTACCAACAAGAGAAGGCACGCATGGGCTCAGCGGGACTCAGAGTTCTTGCT
TTG
GCTTCTGGTCCTGAACTGGGACAGCTGACATTTCTTGGCTTGGTGGGAATCATTGATCCACCTAGAA
CT
GGTGTGAAAGAAGCTGTTACAACACTCATTGCCTCAGGAGTATCAATAAAAATGATTACTGGAGATTC
A
CAGGAGACTGCAGTTGCAATCGCCAGTCGTCTGGGATTGTATTCCAAAACTTCCCAGTCAGTCTCAGGA
GAA
GAAATAGATGCAATGGATGTTCAGCAGCTTTCACAAATAGTACCAAAGGTTGCAGTATTTTACAGAG
CT
AGCCCAAGGCACAAGATGAAAATTATTAAGTCGCTACAGAAGAACGGTTCAGTTGTAGCCATGACAGG
A
GATGGAGTAAATGATGCAGTTGCTCTGAAGGCTGCAGACATTGGAGTTGCGATGGGCCAGACTGGTACA
GAT
GTTTGCAAAGAGGCAGCAGACATGATCCTAGTGGATGATGATTTTCAAACCATAATGTCTGCAATCG
AA
GAGGGTAAAGGGATTTATAATAACATTAAAAATTTCGTTAGATTCCAGCTGAGCACGAGTATAGCAGC
A
TTAACTTTAATCTCATTGGCTACATTAATGAACTTTCCTAATCCTCTCAATGCCATGCAGATTTTGTGG
ATC
AATATTATTATGGATGGACCCCCAGCTCAGAGCCTTGGAGTAGAACCAGTGGATAAAGATGTCATTC
GT
AAACCTCCTCGCAACTGGAAAGACAGCATTTTGACTAAAAACTTGATACTTAAAATACTTGTTTCATC
A
ATAATCATTGTTTGTGGGACTTTGTTTGTCTTCTGGCGTGAGCTACGAGACAATGTGATTACACCTCGA
GAC
ACAACAATGACCTTCACATGCTTTGTGTTTTTTGACATGTTCAATGCACTAAGTTCCAGATCCCAGA
CC
AAGTCTGTGTTTGAGATTGGACTCTGCAGTAATAGAATGTTTTGCTATGCAGTTCTTGGATCCATCAT
G
GGACAATTACTAGTTATTTACTTTCCTCCGCTTCAGAAGGTTTTTCAGACTGAGAGCCTAAGCATACTG
G
AT
CTGTTGTTTCTTTTGGGTCTCACCTCATCAGTGTGCATAGTGGCAGAAATTATAAAGAAGGTTGAAA
GG
AGCAGGGAAAAGATCCAGAAGCATGTCTGGCTCTGGGAGAGGAGTGGACAGCAGCTGGTTGAGATACA
T
CCCCATCTGGAGACAGGACTGCCACTGACAGAAGATGTGAGCTGTGTCTAA


Translation (973 aa):
MDSLLPPSRFSYFKKYPLHAIRRYLSTLRNQRAEEQVARFQKIPNGENETMIPVLTSKKASELPVSEVAS
I
LQ
ADLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSI
T
V
AILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLF
E
AVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFK
M
MQAEE
APKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTV
T
LALGVMRMVKKRAIVKKLPIVETL
GCCNVICSDKTGTLTKNEMTVTHIFTSDGLHAEVTGVGYNQFGEV
I
VDGDVVHGFYNPAVSRIVE
AGCVCNDAVIRNNTLMGKPTEGALIALAMKMGLDGLQQDYIRKAEYPFSS
E
QKWMAVKCVHRTQQ
DRPEICFMKGAYEQVIKYCTTYQSKGQTLTLTQQQRDVYQQEKARMGSAGLRVLA
L
ASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAI
ASRLGLYSKTSQSVSG
E
EIDAMDVQQLSQIVPK
VAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGT
D
VCKEAADMILVDDDFQTI
MSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILW
I
NIIMDGPPAQ
SLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVFWRELRDNVITPR
D
TTMTFTCFVFFDMFNALSSRSQ
TKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSIL
D
LLFLLGLTSSVCIVAEIIKKVERSREKIQKHVWLWERSGQQLVEIHPHLETGLPLTEDVSCV



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser