NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS56230.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
56230.1 Public Homo sapiens 22 EIF3L 22 109 92 CCDS HistoryNCBI Gene:51386Re-query CCDS DB by CCDS ID:56230.1Re-query CCDS DB by GeneID:51386See the combined annotation on chromosome 22 in Sequence Viewer

Public since: CCDS release 9, NCBI annotation release 37.3, Ensembl annotation release 64

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 56230.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000381683.10 ENSP00000371099.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000381683.10Link to Ensembl Protein Viewer:ENSP00000371099.4Re-query CCDS DB by Nucleotide ID:ENST00000381683Re-query CCDS DB by Protein ID:ENSP00000371099
Original member NCBI NM_001242923.1 NP_001229852.1 Updated not alive Link to Nucleotide Sequence:NM_001242923.1Link to Protein Sequence:NP_001229852.1Re-query CCDS DB by Nucleotide ID:NM_001242923Re-query CCDS DB by Protein ID:NP_001229852
Current member NCBI NM_001242923.2 NP_001229852.1 Accepted alive Link to Nucleotide Sequence:NM_001242923.2Link to Protein Sequence:NP_001229852.1Re-query CCDS DB by Nucleotide ID:NM_001242923Re-query CCDS DB by Protein ID:NP_001229852Link to BLAST:NP_001229852.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001229852.1 516 Q9Y262-2 516 100% 0 0

Chromosomal Locations for CCDS 56230.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 22 (NC_000022.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22See the combined annotation on chromosome 22 in Sequence Viewer

Chromosome Start Stop Links
22 37849450 37849482 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 37850015 37850063 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 37851280 37851490 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 37855565 37855644 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 37858679 37858740 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 37870176 37870347 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 37874370 37874524 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 37875841 37876011 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 37877674 37878171 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 37886765 37886845 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 37888426 37888464 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1551 nt):
ATGTCTTATCCCGCTGATGATTATGAGTCTGAGGCGGCTTATGACCCCTACGCTTATCCCAGCGACTATG
AT
ATGCACACAGGAGATCCAAAGCAGGACCTTGCTTATGAACGTCAGTATGAACAGCAAACCTATCAGGT
G
ATCCCTGAGGTGATCAAAAACTTCATCCAGTATTTCCACAAAACTGTCTCAGATTTGATTGACCAGAAA
GTG
TATGAGCTACAGGCCAGTCGTGTCTCCAGTGATGTCATTGACCAGAAGGTGTATGAGATCCAGGACA
TC
TATGAGAACAGCTGGACCAAGCTGACTGAAAGATTCTTCAAGAATACACCTTGGCCCGAGGCTGAAGC
C
ATTGCTCCACAGGTTGGCAATGATGCTGTCTTCCTGATTTTATACAAAGAATTATACTACAGGCACATA
TAT
GCCAAAGTCAGTTTTCAGTCATTCAGTCAGTACCGCTGTAAGACTGCCAAGAAGTCAGAGGAGGAGA
TT
GACTTTCTTCGTTCCAATCCCAAAATCTGGAATGTTCATAGTGTCCTCAATGTCCTTCATTCCCTGGT
A
GACAAATCCAACATCAACCGACAGTTGGAGGTATACACAAGCGGAGGTGACCCTGAGAGTGTGGCTGGG
GAG
TATGGGCGGCACTCCCTCTACAAAATGCTTGGTTACTTCAGCCTGGTCGGGCTTCTCCGCCTGCACT
CC
CTGTTAGGAGATTACTACCAGGCCATCAAGGTGCTGGAGAACATCGAACTGAACAAGAAGAGTATGTA
T
TCCCGTGTGCCAGAGTGCCAGGTCACCACATACTATTATGTTGGGTTTGCATATTTGATGATGCGTCGT
TAC
CAGGATGCCATCCGGGTCTTCGCCAACATCCTCCTCTACATCCAGAGGACCAAGAGCATGTTCCAGA
GG
ACCACGTACAAGTATGAGATGATTAACAAGCAGAATGAGCAGATGCATGCGCTGCTGGCCATTGCCCT
C
ACGATGTACCCCATGCGTATTGATGAGAGCATTCACCTCCAGCTGCGGGAGAAATATGGGGACAAGATG
TTG
CGCATGCAGAAAGGTGACCCACAAGTCTATGAAGAACTTTTCAGTTACTCCTGCCCCAAGTTCCTGT
CG
CCTGTAGTGCCCAACTATGATAATGTGCACCCCAACTACCACAAAGAGCCCTTCCTGCAGCAGCTGAA
G
GTGTTTTCTGATGAAGTACAGCAGCAGGCCCAGCTTTCAACCATCCGCAGCTTCCTGAAGCTCTACACC
ACC
ATGCCTGTGGCCAAGCTGGCTGGCTTCCTGGACCTCACAGAGCAGGAGTTCCGGATCCAGCTTCTTG
TC
TTCAAACACAAGATGAAGAACCTCGTGTGGACCAGCGGTATCTCAGCCCTGGATGGTGAATTTCAGTC
A
GCCTCAGAGGTTGACTTCTACATTGATAAGGACATGATCCACATCGCGGACACCAAGGTCGCCAGGCGT
TAT
GGGGATTTCTTCATCCGTCAGATCCACAAATTTGAGGAGCTTAATCGAACCCTGAAGAAGATGGGAC
AG
AGACCTTGA


Translation (516 aa):
MSYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYERQYEQQTYQVIPEVIKNFIQYFHKTVSDLIDQK
V
YELQASRVSSDVIDQKVYEIQDIYEN
SWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHI
Y
AKVS
FQSFSQYRCKTAKKSEEEIDFLRSNPKIWNVHSVLNVLHSLVDKSNINRQLEVYTSGGDPESVAG
E
YGRHSLYKMLGYFSLVGLLRLHSLLGDYYQAIKVLENIELNKK
SMYSRVPECQVTTYYYVGFAYLMMRR
Y
QDAIRVFANILLYIQRTKSMFQRTTYKYEM
INKQNEQMHALLAIALTMYPMRIDESIHLQLREKYGDKM
L
RMQKGDPQVYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKVFSDEVQQQAQLSTIRSFLKLYT
T
MPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGISALDGEFQSASEVDFYIDK
DMIHIADTKVARR
Y
GDFFIRQIHKFEE
LNRTLKKMGQRP



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser