NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS55968.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
55968.1 Public Homo sapiens 15 ALDH1A2 22 109 92 CCDS HistoryNCBI Gene:8854Re-query CCDS DB by CCDS ID:55968.1Re-query CCDS DB by GeneID:8854See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 9, NCBI annotation release 37.3, Ensembl annotation release 64

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 55968.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000537372.5 ENSP00000438296.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000537372.5Link to Ensembl Protein Viewer:ENSP00000438296.1Re-query CCDS DB by Nucleotide ID:ENST00000537372Re-query CCDS DB by Protein ID:ENSP00000438296
Original member NCBI NM_001206897.1 NP_001193826.1 Updated not alive Link to Nucleotide Sequence:NM_001206897.1Link to Protein Sequence:NP_001193826.1Re-query CCDS DB by Nucleotide ID:NM_001206897Re-query CCDS DB by Protein ID:NP_001193826
Current member NCBI NM_001206897.2 NP_001193826.1 Accepted alive Link to Nucleotide Sequence:NM_001206897.2Link to Protein Sequence:NP_001193826.1Re-query CCDS DB by Nucleotide ID:NM_001206897Re-query CCDS DB by Protein ID:NP_001193826Link to BLAST:NP_001193826.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001193826.1 497 O94788-3 497 100% 0 0

Chromosomal Locations for CCDS 55968.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 15 (NC_000015.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 57955197 57955269 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 57960770 57960844 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 57961137 57961294 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 57962012 57962176 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 57963885 57964069 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 57965725 57965827 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 57992705 57992818 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 57992945 57993073 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 57995078 57995139 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58010649 58010778 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58013858 58013998 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58014177 58014281 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58058012 58058065 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1494 nt):
ATGAAGAATCAGTGTGAGACTGTTTGGTTAAAATCCCCAATAAAACTGAAACTGATCTTTATAAACAACG
AG
TGGCAGAACTCAGAGAGTGGGAGAGTGTTCCCTGTCTATAATCCAGCCACAGGAGAACAGGTGTGTGA
A
GTTCAAGAAGCAGACAAGGCAGATATAGACAAAGCAGTGCAGGCAGCCCGCCTGGCTTTCTCTCTTGGT
TCA
GTGTGGAGAAGGATGGATGCTTCAGAAAGGGGACGTCTGTTGGATAAGCTTGCAGACTTGGTGGAAC
GG
GACAGGGCAGTTCTTGCAACCATGGAATCCCTAAATGGTGGCAAACCATTCCTGCAAGCTTTTTATGT
G
GATTTGCAGGGCGTCATCAAAACCTTTCGATATTACGCAGGCTGGGCTGATAAAATTCATGGGATGACC
ATT
CCTGTAGATGGAGACTATTTTACCTTTACAAGACATGAACCCATTGGAGTGTGTGGACAGATCATCC
CA
TGGAACTTCCCCCTGCTGATGTTTGCCTGGAAAATAGCTCCAGCTTTGTGCTGTGGCAATACAGTAGT
T
ATTAAGCCAGCAGAGCAAACACCACTCAGTGCACTCTACATGGGAGCCCTCATCAAGGAGGCTGGCTTT
CCT
CCCGGGGTCATCAATATTTTGCCAGGATATGGGCCAACGGCTGGGGCAGCAATAGCTTCTCACATTG
GC
ATAGACAAGATTGCATTCACAGGGTCTACTGAGGTTGGAAAGCTTATCCAAGAAGCAGCTGGAAGAAG
T
AATTTGAAGAGAGTAACTCTGGAACTTGGAGGCAAAAGTCCTAATATTATTTTTGCTGATGCTGACTTG
GAC
TATGCTGTGGAGCAGGCCCACCAGGGTGTGTTCTTCAATCAAGGTCAGTGCTGCACTGCAGGCTCTC
GC
ATCTTCGTGGAGGAGTCCATCTATGAGGAGTTTGTGAGAAGAAGCGTGGAGCGGGCCAAGAGGCGCGT
A
GTGGGGAGTCCCTTTGACCCCACCACTGAGCAGGGTCCCCAGATTGATAAGAAACAGTACAACAAGATC
TTG
GAACTCATCCAGAGTGGTGTGGCTGAGGGCGCCAAGCTGGAATGTGGAGGCAAAGGACTGGGCCGAA
AG
GGGTTTTTCATTGAGCCCACAGTGTTTTCCAACGTCACTGATGATATGCGGATTGCCAAGGAGGAGAT
C
TTTGGCCCTGTTCAGGAAATTTTGAGATTTAAGACGATGGATGAAGTTATCGAAAGAGCCAATAACTCA
GAC
TTTGGACTCGTAGCAGCTGTCTTTACTAATGACATCAACAAGGCCCTCACAGTGTCTTCTGCAATGC
AA
GCTGGGACTGTTTGGATCAATTGTTACAATGCCTTAAATGCCCAGAGCCCCTTTGGGGGATTCAAGAT
G
TCTGGAAATGGGAGAGAAATGGGAGAATTTGGCTTGCGGGAGTACTCAGAAGTTAAGACGGTGACAGTA
AAG
ATCCCCCAGAAGAACTCCTAA


Translation (497 aa):
MKNQCETVWLKSPIKLKLIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLG
S
VWRRMDASERGRLLDKLADLVERDRAVLA
TMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMT
I
PV
DGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGF
P
PGVINILPGYGPTAGAAIASHIGIDKIAFTGSTE
VGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADL
D
YAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQ
IDKKQYNKI
L
ELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEE
IFGPVQEILRFKTMDEVIERANNS
D
FGLVAAVFTNDINKALTVSSAMQAGTV
WINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTV
K
IPQKNS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser