NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS55856.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
55856.1 Public Homo sapiens 12 PPFIA2 22 109 92 CCDS HistoryNCBI Gene:8499Re-query CCDS DB by CCDS ID:55856.1Re-query CCDS DB by GeneID:8499See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 9, NCBI annotation release 37.3, Ensembl annotation release 64

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 55856.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000548586.5 ENSP00000449338.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000548586.5Link to Ensembl Protein Viewer:ENSP00000449338.1Re-query CCDS DB by Nucleotide ID:ENST00000548586Re-query CCDS DB by Protein ID:ENSP00000449338
Original member Current member NCBI NM_001220476.2 NP_001207405.1 Accepted alive Link to Nucleotide Sequence:NM_001220476.2Link to Protein Sequence:NP_001207405.1Re-query CCDS DB by Nucleotide ID:NM_001220476Re-query CCDS DB by Protein ID:NP_001207405Link to BLAST:NP_001207405.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001207405.1 1251 O75334-3 1251 100% 0 0

Chromosomal Locations for CCDS 55856.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 81261982 81262040 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81263231 81263390 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81266952 81267020 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81267912 81268087 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81277317 81277414 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81281257 81281432 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81283010 81283039 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81284241 81284303 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81294835 81295035 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81299301 81299382 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81325777 81325870 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81339180 81339334 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81341078 81341208 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81344664 81344693 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81347533 81347770 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81353119 81353339 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81358082 81358217 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81362693 81362784 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81367108 81367170 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81368725 81368856 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81369111 81369194 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81374634 81374768 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81375796 81375942 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81384023 81384244 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81405787 81405903 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81439972 81440046 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81445556 81445720 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81457765 81457866 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81676791 81676844 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81753973 81754221 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3756 nt):
ATGATGTGTGAAGTGATGCCCACGATTAATGAGGACACCCCAATGAGCCAAAGGGGGTCCCAAAGCAGTG
GC
TCGGACTCAGACTCCCATTTTGAGCAGCTGATGGTGAATATGCTAGATGAAAGGGATCGTCTTCTAGA
C
ACCCTTCGGGAGACCCAGGAAAGCCTCTCACTTGCCCAGCAAAGACTTCAGGATGTCATCTATGACCGA
GAC
TCACTCCAGAGACAGCTCAATTCAGCCCTGCCACAGGATATCGAATCCCTAACAGGAGGGCTGGCTG
GT
TCTAAGGGGGCTGATCCACCGGAATTTGCTGCACTGACAAAAGAATTAAATGCCTGCAGGGAACAACT
T
CTAGAAAAGGAAGAAGAAATCTCTGAACTTAAAGCTGAAAGAAACAACACAAGACTATTACTGGAGCAT
TTG
GAGTGCCTTGTGTCACGACATGAAAGATCACTAAGAATGACGGTGGTAAAACGGCAAGCCCAGTCTC
CC
TCAGGAGTATCCAGTGAAGTTGAAGTTCTCAAGGCACTGAAATCTTTGTTTGAGCACCACAAGGCCTT
G
GATGAAAAGGTAAGGGAGCGACTGAGGGTTTCTTTAGAAAGAGTCTCTGCACTGGAAGAAGAACTAGCT
GCT
GCTAATCAGGAGATTGTTGCCTTGCGTGAACAAAATGTTCATATACAAAGAAAAATGGCATCAAGCG
AG
GGATCCACAGAGTCAGAACATCTTGAAGGGATGGAACCTGGACAGAAAGTCCATGAGAAGCGTTTGTC
C
AATGGTTCTATAGACTCAACCGATGAAACTAGTCAAATAGTTGAACTACAAGAATTGCTTGAAAAGCAA
AAC
TATGAAATGGCCCAGATGAAAGAACGTTTAGCAGCCCTTTCTTCCCGAGTGGGAGAGGTGGAACAGG
AA
GCAGAGACAGCAAGAAAGGATCTCATTAAAACAGAAGAAATGAACACCAAGTATCAAAGGGACATTAG
G
GAGGCCATGGCACAAAAGGAAGATATGGAAGAAAGAATTACAACCCTTGAAAAGCGTTACCTCAGTGCT
CAG
AGAGAATCTACCTCCATACATGACATGAATGATAAACTAGAAAATGAGTTAGCAAATAAAGAAGCTA
TC
CTGCGGCAGATGGAAGAGAAAAACAGACAGTTACAAGAACGTCTTGAGCTAGCTGAACAAAAGTTGCA
G
CAGACCATGAGAAAGGCTGAAACCTTGCCTGAAGTAGAGGCTGAACTGGCTCAGAGAATTGCAGCCCTA
ACC
AAGGCTGAAGAGAGACATGGAAATATTGAAGAACGTATGAGACATTTAGAGGGTCAACTTGAAGAGA
AG
AATCAAGAACTTCAAAGAGCTAGGCAAAGAGAGAAAATGAATGAGGAGCATAACAAGAGATTATCGGA
T
ACGGTTGATAGACTTCTGACTGAATCCAATGAACGCCTACAACTACACTTAAAGGAAAGAATGGCTGCT
CTA
GAAGAAAAGAATGTTTTAATTCAAGAATCAGAAACTTTCAGAAAGAATCTTGAAGAATCTTTACATG
AT
AAGGAAAGATTAGCAGAAGAAATTGAAAAGCTGAGATCTGAACTTGACCAATTGAAAATGAGAACTGG
C
TCTTTAATTGAACCCACAATACCAAGAACTCATCTAGACACCTCAGCTGAGTTGCGGTACTCAGTGGGA
TCC
CTAGTGGACAGCCAGTCTGATTACAGAACAACTAAAGTAATAAGAAGACCAAGGAGAGGCCGCATGG
GT
GTGCGAAGAGATGAGCCAAAGGTGAAATCTCTTGGGGATCACGAGTGGAATAGAACTCAACAGATTGG
A
GTACTAAGCAGCCACCCTTTTGAAAGTGACACTGAAATGTCTGATATTGATGATGATGACAGAGAAACA
ATT
TTTAGCTCAATGGATCTTCTCTCTCCAAGTGGTCATTCCGATGCCCAGACGCTAGCCATGATGCTTC
AG
GAACAATTGGATGCCATCAACAAAGAAATCAGGCTAATTCAGGAAGAAAAAGAATCTACAGAGTTGCG
T
GCTGAAGAAATTGAAAATAGAGTGGCTAGTGTGAGCCTCGAAGGCCTGAATTTGGCAAGGGTCCACCCA
GGT
ACCTCCATTACTGCCTCTGTTACAGCTTCATCGCTGGCCAGTTCATCTCCCCCCAGTGGACACTCAA
CT
CCAAAGCTCACCCCTCGAAGCCCTGCCAGGGAAATGGATCGGATGGGAGTCATGACACTGCCAAGTGA
T
CTGAGGAAACATCGGAGAAAGATTGCAGTTGTGGAAGAAGATGGTCGAGAGGACAAAGCAACAATTAAA
TGT
GAAACTTCTCCTCCTCCTACCCCTAGAGCCCTCAGAATGACTCACACTCTCCCTTCTTCCTACCACA
AT
GATGCTCGAAGTAGTTTATCTGTCTCTCTTGAGCCAGAAAGCCTCGGGCTTGGTAGTGCCAACAGCAG
C
CAAGACTCTCTTCACAAAGCCCCCAAGAAGAAAGGAATCAAGTCTTCAATAGGACGTTTGTTTGGTAAA
AAA
GAAAAAGCTCGACTTGGGCAGCTCCGAGGCTTTATGGAGACTGAAGCTGCAGCTCAGGAGTCCCTGG
GG
TTAGGCAAACTCGGAACTCAAGCTGAGAAGGATCGAAGACTAAAGAAAAAGCATGAACTTCTTGAAGA
A
GCTCGGAGAAAGGGATTACCTTTTGCCCAGTGGGATGGGCCAACTGTGGTCGCATGGCTAGAGCTTTGG
TTG
GGAATGCCTGCGTGGTACGTGGCAGCCTGCCGAGCCAACGTGAAGAGTGGTGCCATCATGTCTGCTT
TA
TCTGACACTGAGATCCAGAGAGAAATTGGAATCAGCAATCCACTGCATCGCTTAAAACTTCGATTAGC
A
ATCCAGGAGATGGTTTCCCTAACAAGTCCTTCAGCTCCTCCAACATCTCGAACTCCTTCAGGCAACGTT
TGG
GTGACTCATGAAGAAATGGAAAATCTTGCAGCTCCAGCAAAAACGAAAGAATCTGAGGAAGGAAGCT
GG
GCCCAGACCCTGGCTTATGGAGATATGAATCATGAGTGGATTGGAAATGAATGGCTTCCCAGCTTGGG
G
TTACCTCAGTACAGAAGTTACTTTATGGAATGCTTGGTAGATGCAAGAATGTTAGATCACCTAACAAAA
AAA
GATCTCCGTGTCCATTTAAAAATGGTGGATAGTTTCCATCGAACAAGTTTACAATATGGAATTATGT
GC
TTAAAGAGGTTGAATTATGACAGAAAAGAACTAGAAAGAAGACGGGAAGCAAGCCAACATGAAATAAA
A
GACGTGTTGGTGTGGAGCAATGACCGAGTTATTCGCTGGATACAAGCAATTGGACTTCGAGAATATGCA
AAT
AATATACTTGAGAGCGGTGTGCATGGCTCACTTATAGCCCTGGATGAAAACTTTGACTACAGCAGCT
TA
GCTTTATTATTACAGATTCCAACACAGAACACCCAGGCAAGGCAGATTCTTGAAAGAGAATACAATAA
C
CTCTTGGCCCTGGGAACTGAAAGGCGACTGGATGAAAGTGATGACAAGAACTTCAGACGTGGATCAACC
TGG
AGAAGGCAGTTTCCTCCTCGTGAAGTACATGGAATCAGCATGATGCCTGGGTCCTCAGAAACATTAC
CA
GCTGGATTTAGGTTAACCACAACCTCTGGGCAGTCAAGAAAAATGACAACAGATGTTGCTTCATCAAG
A
CTGCAGAGGTTAGACAACTCCACTGTTCGCACATACTCATGTTGA


Translation (1251 aa):
MMCEVMPTINEDTPMSQRGSQSSGSDSDSHFEQLMVNMLDERDRLLDTLRETQESLSLAQQRLQDVIYDR
D
SLQRQLNSALPQ
DIESLTGGLAGSKGADPPEFAALTKELNACREQLLEKEEEISELKAERNNTRLLLEH
L
ECLVSRHERSLRMTVVKRQAQSPSGVSSEVEVLKALKSLFEHHKALDEK
VRERLRVSLERVSALEEELA
A
ANQE
IVALREQNVHIQRKMASSEGSTESEHLEGMEPGQKVHEKRLSNGSIDSTDETSQIVELQELLEKQ
N
YEMAQMKERLAALSSRVGEVEQEAETARKDLIKTEEMNTKYQRDIRE
AMAQKEDMEERITTLEKRYLSA
Q
RESTSIHDMNDKLENELANKEAILRQ
MEEKNRQLQERLELAEQKLQQTMRKAETLPEVEAELAQRIAAL
T
K
AEERHGNIEERMRHLEGQLEEKNQELQRARQREKMNEEHNKRLSDTVDRLLTESNERLQLHLKERMAA
L
EEK
NVLIQESETFRKNLEESLHDKERLAEEIEKLRSELDQLKMRTGSLIEPTIPRTHLDTSAELRYSVG
S
LVDSQSDYRTTKVIRRPRRGRMGVRRDEPK
VKSLGDHEWNRTQQIGVLSSHPFESDTEMSDIDDDDRET
I
FSSMDLLSPSGHSDAQTLAMMLQEQLDAINKEI
RLIQEEKESTELRAEEIENRVASVSLEGLNLARVHP
G
TSITASVTASSLASSSPPSGHSTPKLTPRSPAREMDRMGVMTL
PSDLRKHRRKIAVVEEDGREDKATIK
C
ETSPPPTPRALRMTHTLPSSYHNDAR
SSLSVSLEPESLGLGSANSSQDSLHKAPKKKGIKSSIGRLFGK
K
EKARLGQL
RGFMETEAAAQESLGLGKLGTQAEKDRRLKKKHELLEEARRKGLPFAQWDGPTVVAWLELW
L
GMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTSRT
PSGNV
W
VTHEEMENLAAPAKT
KESEEGSWAQTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTK
K
DLRVHLKMVDSFH
RTSLQYGIMCLKRLNYDRKELERRREASQHEIKDVLVWSNDRVIRWIQAIGLREYA
N
NILESGVHGSLIALDENFDYSSLALLLQIPTQNTQ
ARQILEREYNNLLALGTERRLDESDDKNFRRGST
W
RRQFPPREVHGISMMPGSSETLPAGFRLTTTSGQSRKMTTD
VASSRLQRLDNSTVRTYSC



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser