NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS55850.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
55850.1 Public Homo sapiens 12 PPFIA2 22 109 92 CCDS HistoryNCBI Gene:8499Re-query CCDS DB by CCDS ID:55850.1Re-query CCDS DB by GeneID:8499See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 9, NCBI annotation release 37.3, Ensembl annotation release 64

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 55850.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000541017.5 ENSP00000445532.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000541017.5Link to Ensembl Protein Viewer:ENSP00000445532.1Re-query CCDS DB by Nucleotide ID:ENST00000541017Re-query CCDS DB by Protein ID:ENSP00000445532
Original member NCBI NM_001220480.2 NP_001207409.1 Updated not alive Link to Nucleotide Sequence:NM_001220480.2Link to Protein Sequence:NP_001207409.1Re-query CCDS DB by Nucleotide ID:NM_001220480Re-query CCDS DB by Protein ID:NP_001207409
Current member NCBI NM_001220480.3 NP_001207409.1 Accepted alive Link to Nucleotide Sequence:NM_001220480.3Link to Protein Sequence:NP_001207409.1Re-query CCDS DB by Nucleotide ID:NM_001220480Re-query CCDS DB by Protein ID:NP_001207409Link to BLAST:NP_001207409.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001207409.1 443 O75334-8 443 100% 0 0

Chromosomal Locations for CCDS 55850.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 81261982 81262040 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81263231 81263390 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81266952 81267020 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81267912 81268087 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81277317 81277414 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81281257 81281450 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81294835 81295035 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81299301 81299382 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81325777 81325870 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81339180 81339334 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 81341078 81341121 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1332 nt):
ATGACTCACACTCTCCCTTCTTCCTACCACAATGATGCTCGAAGTAGTTTATCTGTCTCTCTTGAGCCAG
AA
AGCCTCGGGCTTGGTAGTGCCAACAGCAGCCAAGACTCTCTTCACAAAGCCCCCAAGAAGAAAGGAAT
C
AAGTCTTCAATAGGACGTTTGTTTGGTAAAAAAGAAAAAGCTCGACTTGGGCAGCTCCGAGGCTTTATG
GAG
ACTGAAGCTGCAGCTCAGGAGTCCCTGGGGTTAGGCAAACTCGGAACTCAAGCTGAGAAGGATCGAA
GA
CTAAAGAAAAAGCATGAACTTCTTGAAGAAGCTCGGAGAAAGGGATTACCTTTTGCCCAGTGGGATGG
G
CCAACTGTGGTCGCATGGCTAGAGCTTTGGTTGGGAATGCCTGCGTGGTACGTGGCAGCCTGCCGAGCC
AAC
GTGAAGAGTGGTGCCATCATGTCTGCTTTATCTGACACTGAGATCCAGAGAGAAATTGGAATCAGCA
AT
CCACTGCATCGCTTAAAACTTCGATTAGCAATCCAGGAGATGGTTTCCCTAACAAGTCCTTCAGCTCC
T
CCAACATCTCGAACTTGTCCGGTTTTTCTACAGACCCTGGCTTATGGAGATATGAATCATGAGTGGATT
GGA
AATGAATGGCTTCCCAGCTTGGGGTTACCTCAGTACAGAAGTTACTTTATGGAATGCTTGGTAGATG
CA
AGAATGTTAGATCACCTAACAAAAAAAGATCTCCGTGTCCATTTAAAAATGGTGGATAGTTTCCATCG
A
ACAAGTTTACAATATGGAATTATGTGCTTAAAGAGGTTGAATTATGACAGAAAAGAACTAGAAAGAAGA
CGG
GAAGCAAGCCAACATGAAATAAAAGACGTGTTGGTGTGGAGCAATGACCGAGTTATTCGCTGGATAC
AA
GCAATTGGACTTCGAGAATATGCAAATAATATACTTGAGAGCGGTGTGCATGGCTCACTTATAGCCCT
G
GATGAAAACTTTGACTACAGCAGCTTAGCTTTATTATTACAGATTCCAACACAGAACACCCAGGCAAGG
CAG
ATTCTTGAAAGAGAATACAATAACCTCTTGGCCCTGGGAACTGAAAGGCGACTGGATGAAAGTGATG
AC
AAGAACTTCAGACGTGGATCAACCTGGAGAAGGCAGTTTCCTCCTCGTGAAGTACATGGAATCAGCAT
G
ATGCCTGGGTCCTCAGAAACATTACCAGCTGGATTTAGGTTAACCACAACCTCTGGGCAGTCAAGAAAA
ATG
ACAACAGATGTTGCTTCATCAAGACTGCAGAGGTTAGACAACTCCACTGTTCGCACATACTCATGTT
GA


Translation (443 aa):
MTHTLPSSYHNDARSSLSVSLEPESLGLGSANSSQDSLHKAPKKKGIKSSIGRLFGKKEKARLGQLRGFM
E
TEAAAQESLGLGKLGTQAEKDRRLKK
KHELLEEARRKGLPFAQWDGPTVVAWLELWLGMPAWYVAACRA
N
VKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTSRT
CPVFLQTLAYGDMNHEWI
G
NEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFH
RTSLQYGIMCLKRLNYDRKELERR
R
EASQHEIK
DVLVWSNDRVIRWIQAIGLREYANNILESGVHGSLIALDENFDYSSLALLLQIPTQNTQAR
Q
ILEREYNNLLALGTERRLDE
SDDKNFRRGSTWRRQFPPREVHGISMMPGSSETLPAGFRLTTTSGQSRK
M
TTD
VASSRLQRLDNSTVRTYSC



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser