NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS55540.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
55540.1 Public Homo sapiens X ARHGAP4 22 109 92 CCDS HistoryNCBI Gene:393Re-query CCDS DB by CCDS ID:55540.1Re-query CCDS DB by GeneID:393See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 8, NCBI annotation release 37.2, Ensembl annotation release 62

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 55540.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000370028.7 ENSP00000359045.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000370028.7Link to Ensembl Protein Viewer:ENSP00000359045.3Re-query CCDS DB by Nucleotide ID:ENST00000370028Re-query CCDS DB by Protein ID:ENSP00000359045
Original member Current member NCBI NM_001164741.1 NP_001158213.1 Accepted alive Link to Nucleotide Sequence:NM_001164741.1Link to Protein Sequence:NP_001158213.1Re-query CCDS DB by Nucleotide ID:NM_001164741Re-query CCDS DB by Protein ID:NP_001158213Link to BLAST:NP_001158213.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001158213.1 986 P98171-2 986 100% 0 0

Chromosomal Locations for CCDS 55540.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome X (NC_000023.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 153907729 153907962 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 153909070 153909169 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 153909443 153909535 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 153909741 153909924 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 153910012 153910085 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 153910171 153910404 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 153910506 153910611 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 153910700 153910834 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 153910922 153910999 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 153911129 153911189 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 153912700 153912802 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 153913024 153913051 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 153913218 153913302 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 153913409 153913600 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 153913778 153913879 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 153918832 153919053 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 153919155 153919283 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 153919567 153919686 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 153920626 153920808 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 153921097 153921159 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 153921365 153921527 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 153921605 153921809 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 153926136 153926202 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2961 nt):
ATGGCCGCTCACGGGAAGCTGCGGCGGGAGCGGGGGCTGCAGGCTGAGTATGAGACGCAAGTCAAAGAGA
TG
CGCTGGCAGCTGAGCGAGCAGCTGCGCTGCCTGGAGCTGCAGGGCGAGCTGCGGCGGGAGTTGCTGCA
G
GAGCTGGCAGAGTTCATGCGGCGCCGCGCTGAGGTGGAGCTGGAATACTCCCGGGGCCTGGAAAAGCTG
GCC
GAGCGCTTCTCCAGCCGTGGAGGCCGCCTGGGGAGCAGCCGGGAGCACCAAAGCTTCCGGAAGGAGC
CG
TCCCTCCTGTCGCCCTTGCACTGCTGGGCGGTGCTGCTGCAGCACACGCGGCAGCAGAGCCGGGAGAG
C
GCGGCCCTGAGTGAGGTGCTGGCCGGGCCCCTGGCCCAGCGCCTGAGTCACATTGCAGAGGACGTGGGG
CGC
CTGGTCAAGAAGAGCAGGGATCTGGAGCAGCAGCTGCAGGATGAGCTCCTGGAGGTGGTCTCAGAGC
TC
CAGACGGCCAAGAAGACGTACCAGGCATATCACATGGAGAGCGTGAATGCCGAGGCCAAGCTCCGGGA
G
GCCGAGCGGCAGGAGGAGAAGCGGGCAGGCCGGAGTGTCCCCACCACCACCGCTGGTGCCACTGAGGCA
GGG
CCCCTCCGCAAGAGCTCCCTCAAGAAGGGAGGGAGGCTGGTGGAGAAGCTCTGGCCCCCGCAGAGGC
CT
GTGGCCGCTTCCAGCTGTGCACCTGTGTGCTGGCTCCAAGCTGGGTTTCTCGTGCACCCTCCATGGTG
G
GGTGCCATGTGCGCACCTTCCACTCATCAGCGGCAGGCCAAGTTCATGGAGCACAAACTCAAGTGCACA
AAG
GCGCGCAACGAGTACCTGCTTAGCCTGGCTAGTGTCAACGCTGCTGTCAGTAACTACTACCTGCATG
AC
GTCTTGGACCTCATGGACTGCTGTGACACAGGGTTCCACCTGGCCCTGGGGCAGGTGCTCCGGAGCTA
C
ACGGCCGCTGAGAGCCGCACCCAAGCCTCCCAAGTGCAGGGCCTGGGCAGCCTGGAAGAAGCTGTGGAG
GCC
CTGGATCCTCCAGGGGACAAAGCCAAGGTTCTCGAGGTGCATGCTACCGTCTTCTGTCCCCCGCTGC
GC
TTTGACTACCACCCCCATGATGGGGATGAGGTGGCTGAGATCTGCGTTGAAATGGAGCTGCGGGACGA
G
ATTCTGCCCAGAGCCCAGAACATCCAGAGCCGCCTGGACCGACAGACCATTGAGACAGAGGAGGTGAAC
AAG
ACTCTGAAGGCGACACTGCAGGCCCTGCTGGAGGTGGTGGCCTCGGATGACGGGGATGTGCTTGATT
CC
TTCCAGACCAGCCCCTCCACCGAGTCCCTCAAGTCCACCAGCTCAGACCCAGGCAGCCGGCAGGCGGG
C
CGGAGGCGCGGCCAGCAGCAGGAGACCGAAACCTTCTACCTCACGAAGCTCCAGGAGTATCTGAGTGGA
CGG
AGCATCCTCGCCAAGCTGCAGGCCAAGCACGAGAAGCTGCAGGAGGCCCTTCAGCGAGGTGACAAGG
AG
GAGCAGGAGGTGTCTTGGACCCAGTACACACAGAGAAAATTCCAGAAGAGCCGCCAGCCCCGCCCCAG
C
TCCCAGTATAACCAGAGACTCTTTGGGGGAGACATGGAGAAGTTTATCCAGAGCTCAGGCCAGCCTGTG
CCC
CTGGTGGTGGAGAGCTGCATTCGCTTCATCAACCTCAATGGCCTGCAGCATGAAGGCATCTTCCGGG
TA
TCGGGTGCCCAGCTCCGGGTCTCAGAGATCCGTGATGCCTTCGAGAGAGGGGAGGACCCACTGGTGGA
G
GGCTGCACTGCCCATGACCTGGACTCGGTGGCCGGGGTGCTGAAGCTCTACTTCCGGAGCCTGGAGCCC
CCA
CTCTTCCCCCCAGACCTGTTCGGCGAGCTGCTGGCTTCTTCGGAGCTGGAGGCCACAGCGGAGAGGG
TG
GAGCACGTGAGCCGCCTGCTGTGGCGGCTGCCCGCGCCGGTGCTGGTGGTTCTGCGCTACCTCTTCAC
C
TTCCTCAACCACCTGGCCCAGTACAGCGATGAGAACATGATGGACCCCTACAACCTGGCCGTGTGCTTC
GGG
CCCACGCTGCTACCGGTGCCCGCTGGGCAGGACCCGGTGGCGCTGCAGGGCCGGGTGAACCAGCTGG
TG
CAGACGCTCATAGTGCAGCCCGATCGGGTCTTCCCGCCCCTGACCTCGCTGCCTGGCCCCGTCTACGA
G
AAGTGCATGGCACCGCCTTCCGCCAGCTGCCTGGGGGACGCCCAGCTGGAGAGCCTGGGGGCGGACAAT
GAG
CCGGAGCTGGAAGCCGAGATGCCCGCACAGGAGGATGACCTGGAGGGGGTCGTGGAGGCTGTGGCCT
GC
TTTGCCTACACGGGCCGCACAGCCCAGGAGCTGAGCTTCCGGCGGGGGGACGTACTGCGGCTGCACGA
G
AGGGCCTCGAGCGACTGGTGGCGGGGGGAGCACAACGGCATGCGGGGCCTCATCCCCCACAAGTATATC
ACG
CTGCCCGCCGGGACGGAGAAGCAGGTGGTGGGCGCAGGGCTGCAGACTGCAGGGGAGTCTGGGAGCA
GT
CCCGAGGGCCTCCTGGCATCGGAGCTGGTCCACCGGCCAGAGCCATGCACCTCACCTGAGGCCATGGG
A
CCCTCTGGACACAGACGACGCTGCTTGGTCCCAGCCTCCCCAGAGCAACACGTGGAGGTGGATAAGGCT
GTG
GCACAGAACATGGACTCTGTGTTTAAGGAGCTCTTGGGAAAGACCTCTGTCCGCCAGGGCCTTGGGC
CA
GCATCTACCACCTCTCCCAGTCCTGGGCCCCGAAGCCCAAAGGCCCCGCCCAGCAGCCGCCTGGGCAG
G
AACAAAGGCTTCTCCCGGGGCCCTGGGGCCCCAGCCTCACCCTCAGCTTCCCACCCCCAGGGCCTAGAC
ACG
ACCCCCAAGCCACACTGA


Translation (986 aa):
MAAHGKLRRERGLQAEYETQVKEMRWQLSEQLRCLELQGELRRELLQELAEFMRRRAEVELEYSRGLEKL
A
ERFSSRGGRLGSSREHQSF
RKEPSLLSPLHCWAVLLQHTRQQSRESAALSEVLAGPLAQRLSHIAEDVG
R
LVKK
SRDLEQQLQDELLEVVSELQTAKKTYQAYHMESVNAEAKLREAERQEEKRAGRSVPTTTAGATEA
G
PLRKSSLKKGGRLVEK
LWPPQRPVAASSCAPVCWLQAGFLVHPPWWGAMCAPSTHQRQAKFMEHKLKCT
K
ARNEYLLSLASVNAAVSNYYLHDVLDLMD
CCDTGFHLALGQVLRSYTAAESRTQASQVQGLGSLEEAVE
A
LDPPGDKAKVLEVHATVFCPPLRFDYHPHDGDE
VAEICVEMELRDEILPRAQNIQSRLDRQTIETEEVN
K
TLKATLQALLEVVASDDGDVLDSFQTSPSTESLKSTSSDPGSRQAGRRRGQQQETETFYLT
KLQEYLSG
R
SILAKLQAKHEKLQEALQR
GDKEEQEVSWTQYTQRKFQKSRQPRPSSQYNQRLFGGDMEKFIQSSGQPV
P
LVVESCIRFINLN
GLQHEGIFRVSGAQLRVSEIRDAFERGEDPLVEGCTAHDLDSVAGVLKLYFRSLEP
P
LFPPDLFGELLASS
ELEATAERVEHVSRLLWRLPAPVLVVLRYLFTFLNHLAQYSDENMMDPYNLAVCF
G
PTLLPVPAGQDPVALQGRVNQLVQTLIVQPDRVFPPLTSLPGPVYEKCMAPPSASCL
GDAQLESLGADN
E
PELEAEMPAQED
DLEGVVEAVACFAYTGRTAQELSFRRGDVLRLHERASSDWWRGEHNGMRGLIPHKYI
T
LPA
GTEKQVVGAGLQTAGESGSSPEGLLASELVHRPEPCTSPEAMGPSGHRRRCLVPASPEQHVEVDKA
V
AQNMDSVFKELLGKTSVRQGLGPASTTSPSPGPRSPKAPPSSRLGRNKGFSRGPGAPASPSASHPQGLD
T
TPKPH




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser