NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS55506.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
55506.1 Public Homo sapiens X FHL1 20 108 85 CCDS HistoryNCBI Gene:2273Re-query CCDS DB by CCDS ID:55506.1Re-query CCDS DB by GeneID:2273See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 8, NCBI annotation release 37.2, Ensembl annotation release 62

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 55506.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000370683 ENSP00000359717 Accepted alive Link to Ensembl Transcript Viewer:ENST00000370683Link to Ensembl Protein Viewer:ENSP00000359717Re-query CCDS DB by Nucleotide ID:ENST00000370683Re-query CCDS DB by Protein ID:ENSP00000359717
Original member Current member EBI,WTSI OTTHUMT00000058463 OTTHUMP00000024100 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000058463Link to Vega Protein Viewer:OTTHUMP00000024100Re-query CCDS DB by Nucleotide ID:OTTHUMT00000058463Re-query CCDS DB by Protein ID:OTTHUMP00000024100
Original member Current member NCBI NM_001159699.1 NP_001153171.1 Accepted alive Link to Nucleotide Sequence:NM_001159699.1Link to Protein Sequence:NP_001153171.1Re-query CCDS DB by Nucleotide ID:NM_001159699Re-query CCDS DB by Protein ID:NP_001153171Link to BLink:NP_001153171.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001153171.1 296 Q13642-5 296 100% 0 0

Chromosomal Locations for CCDS 55506.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '+' strand of Chromosome X (NC_000023.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 136197113 136197134 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 136206407 136206588 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 136207016 136207190 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 136207792 136207961 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 136208455 136208641 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 136209871 136210025 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (891 nt):
ATGGCTTCCCATAGACACTCAGGTCCCTCCAGCTACAAGGTGGGCACCATGGCGGAGAAGTTTGACTGCC
AC
TACTGCAGGGATCCCTTGCAGGGGAAGAAGTATGTGCAAAAGGATGGCCACCACTGCTGCCTGAAATG
C
TTTGACAAGTTCTGTGCCAACACCTGTGTGGAATGCCGCAAGCCCATCGGTGCGGACTCCAAGGAGGTG
CAC
TATAAGAACCGCTTCTGGCATGACACCTGCTTCCGCTGTGCCAAGTGCCTTCACCCCTTGGCCAATG
AG
ACCTTTGTGGCCAAGGACAACAAGATCCTGTGCAACAAGTGCACCACTCGGGAGGACTCCCCCAAGTG
C
AAGGGGTGCTTCAAGGCCATTGTGGCAGGAGATCAAAACGTGGAGTACAAGGGGACCGTCTGGCACAAA
GAC
TGCTTCACCTGTAGTAACTGCAAGCAAGTCATCGGGACTGGAAGCTTCTTCCCTAAAGGGGAGGACT
TC
TACTGCGTGACTTGCCATGAGACCAAGTTTGCCAAGCATTGCGTGAAGTGCAACAAGGCCATCACATC
T
GGAGGAATCACTTACCAGGATCAGCCCTGGCATGCCGATTGCTTTGTGTGTGTTACCTGCTCTAAGAAG
CTG
GCTGGGCAGCGTTTCACCGCTGTGGAGGACCAGTATTACTGCGTGGATTGCTACAAGAACTTTGTGG
CC
AAGAAGTGTGCTGGATGCAAGAACCCCATCACTGGGTTTGGTAAAGGCTCCAGTGTGGTGGCCTATGA
A
GGACAATCCTGGCACGACTACTGCTTCCACTGCAAAAAATGCTCCGTGAATCTGGCCAACAAGCGCTTT
GTT
TTCCACCAGGAGCAAGTGTATTGTCCCGACTGTGCCAAAAAGCTGTAA


Translation (296 aa):
MASHRHSGPSSYKVGTMAEKFDCHYCRDPLQGKKYVQKDGHHCCLKCFDKFCANTCVECRKPIGADSKEV
H
YKNRFWHDTCFRCAKCLHPLANETFVAKDNKILCNKCTTREDSPKCKGCFKAIVA
GDQNVEYKGTVWHK
D
CFTCSNCKQVIGTGSFFPKGEDFYCVTCHETKFAKHCVKCNK
AITSGGITYQDQPWHADCFVCVTCSKK
L
AGQRFTAVEDQYYCVDCYKNFVAKKCAGCKNPIT
GFGKGSSVVAYEGQSWHDYCFHCKKCSVNLANKRF
V
FHQEQVYCPDCAKKL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser