NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS55408.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
55408.1 Public Homo sapiens X CDK16 22 109 92 CCDS HistoryNCBI Gene:5127Re-query CCDS DB by CCDS ID:55408.1Re-query CCDS DB by GeneID:5127See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 8, NCBI annotation release 37.2, Ensembl annotation release 62

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 55408.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000276052.10 ENSP00000276052.6 Accepted alive Link to Ensembl Transcript Viewer:ENST00000276052.10Link to Ensembl Protein Viewer:ENSP00000276052.6Re-query CCDS DB by Nucleotide ID:ENST00000276052Re-query CCDS DB by Protein ID:ENSP00000276052
Original member Current member NCBI NM_001170460.1 NP_001163931.1 Accepted alive Link to Nucleotide Sequence:NM_001170460.1Link to Protein Sequence:NP_001163931.1Re-query CCDS DB by Nucleotide ID:NM_001170460Re-query CCDS DB by Protein ID:NP_001163931Link to BLAST:NP_001163931.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001163931.1 570 Q00536-2 570 100% 0 0

Chromosomal Locations for CCDS 55408.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome X (NC_000023.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 47223096 47223311 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 47223552 47223759 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 47224385 47224518 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 47224618 47224743 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 47224834 47224890 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 47224988 47225102 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 47225772 47225866 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 47225965 47226027 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 47226279 47226402 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 47226583 47226703 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 47226812 47226909 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 47226994 47227099 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 47227181 47227223 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 47227379 47227469 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 47228567 47228644 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 47228731 47228768 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1713 nt):
ATGCCACTCTATGGCCGTGCTCGAGACCATGTCACCCATCCTTCAATTCTGGGCACACGCCCTGGCCGAC
CC
ATGGCTGGGCCCATCACTGCAGCTGTACCTGAGAAGATCTGCAATGGAGCCTTCTGCTCCTGCAGTGG
G
GCTTTTCCCCTAGATCCCAACAATCCATCGTTAGGGCCCTTGCCCTCAATCAGCCACCTAAATCTGAGA
ACT
CAGATCGCCATGGATCGGATGAAGAAGATCAAACGGCAGCTGTCAATGACACTCCGAGGTGGCCGAG
GC
ATAGACAAGACCAATGGTGCCCCTGAGCAGATAGGCCTGGATGAGAGTGGTGGTGGTGGCGGCAGTGA
C
CCTGGAGAGGCCCCCACACGTGCTGCTCCTGGGGAACTTCGTTCTGCACGGGGCCCACTCAGCTCTGCA
CCA
GAGATTGTGCACGAGGACTTGAAGATGGGGTCTGATGGGGAGAGTGACCAGGCTTCAGCCACGTCCT
CG
GATGAGGTGCAGTCTCCAGTGAGAGTGCGTATGCGCAACCATCCCCCACGCAAGATCTCCACTGAGGA
C
ATCAACAAGCGCCTATCACTACCAGCTGACATCCGGCTGCCTGAGGGCTACCTGGAGAAGCTGACCCTC
AAT
AGCCCCATCTTTGACAAGCCCCTCAGCCGCCGCCTCCGTCGTGTCAGCCTATCTGAGATTGGCTTTG
GG
AAACTGGAGACCTACATTAAGCTGGACAAACTGGGCGAGGGTACCTATGCCACCGTCTACAAAGGCAA
A
AGCAAGCTCACAGACAACCTTGTGGCACTCAAGGAGATCAGACTGGAACATGAAGAGGGGGCACCCTGC
ACC
GCCATCCGGGAAGTGTCCCTGCTCAAGGACCTCAAACACGCCAACATCGTTACGCTACATGACATTA
TC
CACACGGAGAAGTCCCTCACCCTTGTCTTTGAGTACCTGGACAAGGACCTGAAGCAGTACCTGGATGA
C
TGTGGGAACATCATCAACATGCACAACGTGAAACTGTTCCTGTTCCAGCTGCTCCGTGGCCTGGCCTAC
TGC
CACCGGCAGAAGGTGCTACACCGAGACCTCAAGCCCCAGAACCTGCTCATCAACGAGAGGGGAGAGC
TC
AAGCTGGCTGACTTTGGCCTGGCCCGAGCCAAGTCAATCCCAACAAAGACATACTCCAATGAGGTGGT
G
ACACTGTGGTACCGGCCCCCTGACATCCTGCTTGGGTCCACGGACTACTCCACTCAGATTGACATGTGG
GGT
GTGGGCTGCATCTTCTATGAGATGGCCACAGGCCGTCCCCTCTTTCCGGGCTCCACGGTGGAGGAAC
AG
CTACACTTCATCTTCCGTATCTTAGGAACCCCAACTGAGGAGACGTGGCCAGGCATCCTGTCCAACGA
G
GAGTTCAAGACATACAACTACCCCAAGTACCGAGCCGAGGCCCTTTTGAGCCACGCACCCCGACTTGAT
AGC
GACGGGGCCGACCTCCTCACCAAGCTGTTGCAGTTTGAGGGTCGAAATCGGATCTCCGCAGAGGATG
CC
ATGAAACATCCATTCTTCCTCAGTCTGGGGGAGCGGATCCACAAACTTCCTGACACTACTTCCATATT
T
GCACTAAAGGAGATTCAGCTACAAAAGGAGGCCAGCCTTCGGTCTTCGTCGATGCCTGACTCAGGCAGG
CCA
GCTTTCCGCGTGGTGGACACCGAGTTCTAA


Translation (570 aa):
MPLYGRARDHVTHPSILGTRPGRPMAGPITAAVPEKICNGAFCSCSGAFPLDPNNPSLGPLPSISHLNLR
T
Q
IAMDRMKKIKRQLSMTLRGGRGIDKTNGAPEQIGLDESGGGGGSDPGEAPTRAAPGELRSARGPLSSA
P
EIVHEDLKMGSDGESDQASATSSDEVQSPVRVRMRNHPPRKISTEDINKRLSLPADIRLPEGYLEKLTL
N
SPIFDKPLSRRLRRVSL
SEIGFGKLETYIKLDKLGEGTYATVYKGKSKLTDNLVALKEIRLEHEEGAPC
T
AIRE
VSLLKDLKHANIVTLHDIIHTEKSLTLVFEYLDKDLKQYLDDCGNIINMHNVKLFLFQLLRGLAY
C
HRQKVLHRDLKPQNLLINERGELKLADF
GLARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMW
G
VGCIFYEMATGRPLFPGSTVEEQLHFIFRIL
GTPTEETWPGILSNEEFKTYNYPKYRAEALLSHAPRLD
S
DGADLLTKLLQ
FEGRNRISAEDAMKHPFFLSLGERIHKLPDTTSIFALKEIQLQKEASLRSSSMPDSGR
P
AFRVVDTEF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser