NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS55219.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
55219.1 Public Homo sapiens 8 NRG1 22 109 92 CCDS HistoryNCBI Gene:3084Re-query CCDS DB by CCDS ID:55219.1Re-query CCDS DB by GeneID:3084See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 8, NCBI annotation release 37.2, Ensembl annotation release 62

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 55219.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000523079.5 ENSP00000430120.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000523079.5Link to Ensembl Protein Viewer:ENSP00000430120.1Re-query CCDS DB by Nucleotide ID:ENST00000523079Re-query CCDS DB by Protein ID:ENSP00000430120
Original member NCBI NM_001160008.1 NP_001153480.1 Updated not alive Link to Nucleotide Sequence:NM_001160008.1Link to Protein Sequence:NP_001153480.1Re-query CCDS DB by Nucleotide ID:NM_001160008Re-query CCDS DB by Protein ID:NP_001153480
Current member NCBI NM_001160008.2 NP_001153480.1 Accepted alive Link to Nucleotide Sequence:NM_001160008.2Link to Protein Sequence:NP_001153480.1Re-query CCDS DB by Nucleotide ID:NM_001160008Re-query CCDS DB by Protein ID:NP_001153480Link to BLAST:NP_001153480.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001153480.1 420 Q02297-12 420 100% 0 0

Chromosomal Locations for CCDS 55219.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 8 (NC_000008.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 32548727 32548826 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 32595828 32596005 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 32605562 32605683 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 32614514 32614564 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 32616835 32616885 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 32727949 32728078 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 32742675 32742733 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 32754372 32754474 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 32756403 32756529 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 32759306 32759436 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 32760200 32760410 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1263 nt):
ATGTCCGAGCGCAAAGAAGGCAGAGGCAAAGGGAAGGGCAAGAAGAAGGAGCGAGGCTCCGGCAAGAAGC
CG
GAGTCCGCGGCGGGCAGCCAGAGCCCAGCCTTGCCTCCCCGATTGAAAGAGATGAAAAGCCAGGAATC
G
GCTGCAGGTTCCAAACTAGTCCTTCGGTGTGAAACCAGTTCTGAATACTCCTCTCTCAGATTCAAGTGG
TTC
AAGAATGGGAATGAATTGAATCGAAAAAACAAACCACAAAATATCAAGATACAAAAAAAGCCAGGGA
AG
TCAGAACTTCGCATTAACAAAGCATCACTGGCTGATTCTGGAGAGTATATGTGCAAAGTGATCAGCAA
A
TTAGGAAATGACAGTGCCTCTGCCAATATCACCATCGTGGAATCAAACGAGATCATCACTGGTATGCCA
GCC
TCAACTGAAGGAGCATATGTGTCTTCAGAGTCTCCCATTAGAATATCAGTATCCACAGAAGGAGCAA
AT
ACTTCTTCATCTACATCTACATCCACCACTGGGACAAGCCATCTTGTAAAATGTGCGGAGAAGGAGAA
A
ACTTTCTGTGTGAATGGAGGGGAGTGCTTCATGGTGAAAGACCTTTCAAACCCCTCGAGATACTTGTGC
AA
G
TGCCCAAATGAGTTTACTGGTGATCGCTGCCAAAACTACGTAATGGCCAGCTTCTACAAGGCGGAGG
AG
CTGTACCAGAAGAGAGTGCTGACCATAACCGGCATCTGCATCGCCCTCCTTGTGGTCGGCATCATGTG
T
GTGGTGGCCTACTGCAAAACCAAGAAACAGCGGAAAAAGCTGCATGACCGTCTTCGGCAGAGCCTTCGG
TCT
GAACGAAACAATATGATGAACATTGCCAATGGGCCTCACCATCCTAACCCACCCCCCGAGAATGTCC
AG
CTGGTGAATCAATACGTATCTAAAAACGTCATCTCCAGTGAGCATATTGTTGAGAGAGAAGCAGAGAC
A
TCCTTTTCCACCAGTCACTATACTTCCACAGCCCATCACTCCACTACTGTCACCCAGACTCCTAGCCAC
AG
C
TGGAGCAACGGACACACTGAAAGCATCCTTTCCGAAAGCCACTCTGTAATCGTGATGTCATCCGTAG
AA
AACAGTAGGCACAGCAGCCCAACTGGGGGCCCAAGAGGACGTCTTAATGGCACAGGAGGCCCTCGTGA
A
TGTAACAGCTTCCTCAGGCATGCCAGAGAAACCCCTGATTCCTACCGAGACTCTCCTCATAGTGAAAGG
TAA


Translation (420 aa):
MSERKEGRGKGKGKKKERGSGKKPESAAGSQSPALPPRLKEMKSQESAAGSKLVLRCETSSEYSSLRFKW
F
KNGNELNRKNKPQNIKIQKKP
GKSELRINKASLADSGEYMCKVISKLGNDSASANITIVESNEIITGMP
A
STEGAYVSS
ESPIRISVSTEGANTSSSTSTSTTGTSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLC
K
CPNEFTGDRCQNYVMASFYKAEELYQKRVLTITGICIALLVVGIMCVVAYCKTKKQRKKLHDRLRQSLR
S
ERNNMMNIANGPHHPNPPPENVQLVN
QYVSKNVISSEHIVEREAETSFSTSHYTSTAHHSTTVTQTPSH
S
WSNGHTESILSESHSVIVMSSVENSRHSSPTGGPRGRLNGTGGPRECNSFLRHARETPDSYRDSPHSER



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser