NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS55195.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
55195.1 Public Homo sapiens 8 CLDN23 22 109 92 CCDS HistoryNCBI Gene:137075Re-query CCDS DB by CCDS ID:55195.1Re-query CCDS DB by GeneID:137075See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 8, NCBI annotation release 37.2, Ensembl annotation release 62

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 55195.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000519106.1 ENSP00000428780.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000519106.1Link to Ensembl Protein Viewer:ENSP00000428780.1Re-query CCDS DB by Nucleotide ID:ENST00000519106Re-query CCDS DB by Protein ID:ENSP00000428780
Original member Current member NCBI NM_194284.2 NP_919260.2 Accepted alive Link to Nucleotide Sequence:NM_194284.2Link to Protein Sequence:NP_919260.2Re-query CCDS DB by Nucleotide ID:NM_194284Re-query CCDS DB by Protein ID:NP_919260Link to BLAST:NP_919260.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_919260.2 292 Q96B33 292 100% 0 0

Chromosomal Locations for CCDS 55195.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 8 (NC_000008.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 8702399 8703277 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (879 nt):
ATGCGGACGCCGGTGGTGATGACGCTGGGCATGGTGTTGGCGCCCTGCGGGCTCCTGCTCAACCTGACCG
GC
ACCCTGGCGCCCGGCTGGCGGCTGGTGAAGGGCTTCCTGAACCAGCCAGTGGACGTGGAGTTGTACCA
G
GGCCTGTGGGACATGTGTCGCGAGCAGAGCAGCCGCGAGCGCGAGTGCGGCCAGACGGACCAGTGGGGC
TAC
TTCGAGGCCCAGCCCGTGCTGGTGGCGCGGGCACTCATGGTCACCTCGCTGGCCGCCACGGTCCTGG
GG
CTTCTGCTGGCGTCGCTGGGCGTGCGCTGCTGGCAGGACGAGCCCAACTTCGTGCTGGCAGGGCTCTC
G
GGCGTCGTGCTCTTCGTCGCTGGCCTCCTCGGCCTCATCCCGGTGTCCTGGTACAACCACTTCTTGGGG
GAC
CGCGACGTGCTGCCCGCCCCGGCCAGCCCGGTCACGGTGCAGGTCAGCTACAGCCTGGTCCTGGGCT
AC
CTGGGCAGCTGCCTCCTGCTGCTGGGCGGCTTCTCGCTGGCGCTCAGCTTCGCGCCCTGGTGCGACGA
G
CGTTGTCGCCGCCGCCGCAAGGGACCCTCCGCCGGGCCTCGCCGCAGCAGCGTCAGCACCATCCAAGTG
GAG
TGGCCCGAGCCCGACCTGGCGCCCGCCATCAAGTACTACAGCGACGGCCAGCACCGACCGCCGCCTG
CC
CAGCACCGCAAGCCCAAGCCCAAGCCCAAGGTCGGCTTCCCCATGCCGCGGCCGCGGCCCAAGGCCTA
C
ACCAACTCGGTGGACGTCCTCGACGGGGAGGGGTGGGAGTCCCAGGACGCTCCCTCGTGCAGCACCCAC
CCC
TGCGACAGCTCGCTGCCCTGCGACTCCGACCTCTAG


Translation (292 aa):
MRTPVVMTLGMVLAPCGLLLNLTGTLAPGWRLVKGFLNQPVDVELYQGLWDMCREQSSRERECGQTDQWG
Y
FEAQPVLVARALMVTSLAATVLGLLLASLGVRCWQDEPNFVLAGLSGVVLFVAGLLGLIPVSWYNHFLG
D
RDVLPAPASPVTVQVSYSLVLGYLGSCLLLLGGFSLALSFAPWCDERCRRRRKGPSAGPRRSSVSTIQV
E
WPEPDLAPAIKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWESQDAPSCSTH
P
CDSSLPCDSDL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser