NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Thursday, April 25, 2024, starting at 7:00 a.m. EDT for up to 120 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS55017.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
55017.1 Public Homo sapiens 6 TDRD6 24 110 108 CCDS HistoryNCBI Gene:221400Re-query CCDS DB by CCDS ID:55017.1Re-query CCDS DB by GeneID:221400See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 8, NCBI annotation release 37.2, Ensembl annotation release 62

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 55017.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000544460.5 ENSP00000443299.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000544460.5Link to Ensembl Protein Viewer:ENSP00000443299.1Re-query CCDS DB by Nucleotide ID:ENST00000544460Re-query CCDS DB by Protein ID:ENSP00000443299
Original member Current member NCBI NM_001168359.2 NP_001161831.1 Accepted alive Link to Nucleotide Sequence:NM_001168359.2Link to Protein Sequence:NP_001161831.1Re-query CCDS DB by Nucleotide ID:NM_001168359Re-query CCDS DB by Protein ID:NP_001161831Link to BLAST:NP_001161831.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001161831.1 2066 O60522-2 2066 100% 0 0

Chromosomal Locations for CCDS 55017.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 6 (NC_000006.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 46688129 46694174 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 46695821 46695945 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 46701858 46701887 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (6201 nt):
ATGTGCTCGACGCCCGGAATGCCGGCGCCGGGGGCCTCGCTGGCCCTGCGGGTGTCCTTCGTGGACGTGC
AT
CCCGATGTGATCCCGGTGCAGCTGTGGGGGCTGGTGGGCGAGCGGCGGGGCGAGTACCTGCGGCTGAG
C
CGGGAAATCCAGGAAGCGGCGGCCACGCGCGGCCAGTGGGCGCTGGGCAGCGCCTCGGCCTCGCCCGGC
GAG
CTGTGCCTGGTGCAGGTCGGGCTTTTGTGGCACCGCTGCCGCGTGGTCAGCCGGCAGGCACAGGAGA
GC
CGTGTCTTCCTGCTGGACGAGGGCCGCACCATCACGGCCGGAGCAGGCTCGCTGGCGCCTGGGCGCAG
A
GAGTTCTTCAATTTGCCCTCGGAAGTGCTGGGCTGCGTGCTAGCGGGCCTGGTGCCGGCAGGCTGCGGC
GCG
GGCTCAGGCGAGCCGCCGCAGCACTGGCCCGCCGACGCCGTGGACTTCCTTAGCAACCTTCAGGGCA
AG
GAGGTGCACGGGTGCGTCCTGGACGTGCTGCTGCTCCATCGCCTGGTCCTCCTGGAGGTGCCTGATGT
G
TTCCAACAGATGCGGGAGCTGGGCCTGGCTCGGCGGGTGCCCGACAGCCTCTTCCGTTCGCTGCTGGAG
CGC
TATCTCACAGCGGCCACTGCTAGCGTGGGCTCCGGGGTCCCGGTTCTCTCGCGAGTCCCGCTCAAGC
AA
AAGCAGCCTGGTCTGGATTACTTCTATCCCCAGCTGCAGCTGGGCGTGACGGAGGCCGTGGTCATAAC
C
CAAGTGTGCCATCCCCACCGCATTCACTGCCAGCTCCGCAGCGTCTCGCAGGAGATCCACCGCCTCTCC
GAG
AGCATGGCCCAGGTATACCGGGGTTCCACGGGGACAGGGGATGAGAACTCTACCAGTGCCACCTGGG
AG
GAGAGGGAGGAGAGCCCAGATAAGCCGGGCTCTCCGTGTGCATCCTGTGGCCTGGATGGACATTGGTA
C
AGAGCACTGTTGCTTGAGACTTTTCGGCCCCAGCGCTGTGCCCAGGTGCTTCATGTGGACTATGGAAGG
AAG
GAGTTAGTGAGTTGCAGCAGCCTTCGGTACTTGCTGCCTGAATATTTTCGAATGCCGGTGGTGACCT
AC
CCTTGTGCTTTGTATGGACTCTGGGACGGTGGGAGAGGCTGGTCTCGGTCACAGGTCGGTGACCTGAA
G
ACACTGATACTAGGCAAGGCAGTGAATGCAAAGATTGAATTTTATTGCTCCTTTGAGCATGTGTATTAT
GTC
AGCCTGTATGGAGAAGATGGGATTAATCTGAACCGTGTGTTTGGAGTACAGTCGTGTTGCTTGGCTG
AC
CGAGTCCTTCAGAGCCAGGCAACAGAGGAGGAGGAACCAGAAACATCTCAGTCTCAGTCTCCTGCTGA
A
GAAGTAGATGAAGAGATTTCACTCCCAGCCTTAAGATCTATCAGGTTAAAGATGAATGCCTTCTACGAT
GCG
CAGGTAGAGTTTGTTAAAAATCCTTCTGAGTTTTGGATTAGGTTGAGGAAACACAATGTCACCTTCA
GT
AAGCTGATGAGGAGAATGTGTGGTTTCTATTCCTCTGCCAGTAAGCTGGATGGTGTAGTTTTGAAACC
T
GAACCTGATGACCTTTGCTGTGTCAAGTGGAAAGAAAATGGTTATTATAGGGCCATAGTCACCAAATTG
GAT
GACAAGAGTGTGGATGTATTCTTAGTTGACCGAGGCAATTCGGAAAATGTGGACTGGTATGACGTAA
GG
ATGCTGCTTCCTCAGTTTAGGCAGCTACCAATATTGGCTGTGAAGTGCACCCTGGCTGATATTTGGCC
T
TTGGGAAAAACTTGGAGCCAGGAGGCAGTTTCCTTTTTTAAAAAGACTGTGCTCCACAAAGAATTAGTC
ATC
CATATTCTTGATAAACAGGATCATCAATATGTTATTGAGATTCTTGACGAATCAAGAACAGGGGAAG
AA
AACATTAGTAAGGTAATTGCCCAAGCTGGATATGCCAAGTATCAGGAATTTGAAACAAAGGAAAATAT
C
CTGGTAAATGCCCACTCCCCAGGGCATGTTTCAAACCACTTTACTACGGAGAGTAACAAAATACCTTTT
GCC
AAGACTGGAGAAGGAGAGCAGAAAGCCAAGAGAGAGAATAAAACCACATCTGTTTCAAAAGCTTTGA
GT
GACACAACAGTTGTAACAAATGGTTCAACTGAACTAGTTGTGCAGGAAAAAGTGAAAAGAGCATCTGT
T
TATTTTCCTCTTATGCAGAATTGCTTGGAAATTAAGCCAGGCTCCTCTAGTAAAGGAGAGCTGGAAGTT
GGA
AGTACAGTAGAAGTCAGAGTGTCTTATGTTGAAAACCCTGGCTATTTCTGGTGTCAGCTGACCAGGA
AC
ATACAAGGACTTAAAACTCTAATGTCTGATATTCAGTACTATTGCAAAAATACAGCTGCTCCTCACCA
G
AGAAACACCCTTGCTTGTTTGGCTAAGCGAACAGTAAACAGACAGTGGTCCAGAGCACTTATTAGTGGG
ATA
CAGTCTGTGGAGCATGTCAATGTAACATTTGTAGATTATGGAGACAGAGAAATGGTATCTGTGAAGA
AT
ATTTATTCAATTAGTGAAGAATTTCTGAAGGTTAAGGCACAGGCTTTTAGGTGCAGTCTTTATAATTT
A
ATTCAACCAGTTGGCCAGAATCCCTTTGTTTGGGATGTAAAGGCAATACAAGCTTTCAATGAATTTATA
GAT
AATGCATGGCAAAAAAATCTAGAATTAAAATGTACAATATTTGCTCTGGCTTCAATTAATGAAGAAC
TG
TTTAACATTGTGGATTTGCTAACCCCCTTTCAGAGTGCATGCCATTTCTTGGTAGAAAAGAGACTTGC
A
AGACCAGTAAAACTTCAGAAGCCTTTGGAGTCCTCTGTTCAGCTACATTCCTACTTCTATTCTACACAT
GAT
ATGAAAATTGGAAGTGAAGAATTAGTTTATATAACGCATATTGATGACCCTTGGACATTTTATTGCC
AG
CTGGCAAGAAATGCAAATATTTTAGAACAGTTGTCATGTAGTATTACACAATTAAGTAAAGTTTTGCT
G
AATTTAAAAACATCTCCCTTGAACCCTGGAACCTTGTGCCTTGCCAAGTATACTGATGGAAACTGGTAT
AGG
GGCATAGTAATAGAGAAAGAGCCAAAGAAAGTCTTCTTTGTTGATTTTGGGAATATTTATGTAGTAA
CA
AGTGATGATCTGCTTCCAATACCTAGTGATGCATATGATGTCTTACTTTTGCCCATGCAAGCTGTCAG
A
TGTTCATTATCTGATATTCCTGATCATATACCAGAAGAAGTGGTGGTGTGGTTTCAGGAGACTATTTTA
GAT
AAGTCATTGAAGGCTTTAGTTGTAGCAAAAGATCCAGATGGAACACTGATTATAGAACTATATGGTG
AC
AATATTCAAATTAGTGCTAGTATTAATAAGAAGTTGGGGCTACTTAGTTACAAAGATAGAATAAGAAA
A
AAAGAAAGTGAAGTCCTCTGTTCTACAACTGAAACTCTTGAAGAAAAAAATGAGAATATGAAGTTGCCA
TGT
ACAGAGTATTTAAGTAAATCAGTAGGGTACAAGTTACCTAATAAAGAAATTTTGGAAGAGTCATATA
AA
CCTCAGATCAACTCATCATACAAGGAACTCAAACTTTTACAAAGTTTAACAAAAACAAACTTAGTCAC
T
CAATATCAAGACTCTGTGGGAAATAAAAATAGTCAAGTGTTTCCATTAACAACAGAAAAGAAAGAAGAA
ATT
TCTGCTGAGACACCCTTGAAAACAGCAAGAGTAGAAGCTACTCTTTCAGAGAGAAAAATAGGAGATT
CA
TGTGACAAAGATTTGCCTCTGAAATTTTGTGAGTTCCCACAGAAGACTATAATGCCTGGATTTAAAAC
A
ACTGTATATGTTTCTCATATAAATGACCTTTCAGACTTTTATGTTCAACTAATAGAAGATGAAGCTGAA
ATT
AGTCATCTTTCAGAGAGATTAAACAGTGTTAAAACAAGGCCCGAATATTATGTAGGTCCACCTTTGC
AA
AGAGGAGATATGATATGTGCTGTTTTCCCAGAAGATAATTTATGGTATCGTGCTGTGATCAAGGAGCA
A
CAACCCAATGACCTTCTCTCTGTGCAGTTTATAGATTATGGCAATGTTTCTGTGGTTCATACTAACAAA
ATA
GGTAGGCTTGACCTTGTTAATGCAATATTGCCGGGGTTGTGCATTCATTGCTCCTTGCAGGGATTTG
AG
GTTCCTGACAATAAAAATTCTAAGAAAATGATGCATTACTTTTCCCAACGGACCAGCGAGGCTGCAAT
A
AGATGTGAATTTGTTAAATTTCAAGACAGATGGGAAGTTATTCTTGCTGATGAACATGGGATCATAGCA
GAT
GATATGATTAGCAGGTATGCTCTCAGTGAAAAATCTCAAGTAGAACTTTCTACCCAAGTAATTAAAA
GT
GCCAGTTCAAAGTCTGTTAACAAATCAGACATTGACACTTCAGTATTTCTTAACTGGTATAATCCAGA
A
AAAAAAATGATAAGAGCTTATGCCACTGTGATAGATGGACCTGAGTACTTTTGGTGTCAGTTTGCTGAT
ACG
GAGAAACTTCAGTGTTTAGAAGTAGAAGTACAGACTGCTGGAGAACAGGTAGCAGACAGGAGAAATT
GT
ATCCCATGTCCTTATATTGGAGATCCTTGTATAGTAAGATACAGAGAAGATGGACATTATTATAGGGC
A
CTTATCACTAATATTTGTGAAGATTATCTTGTATCTGTCAGGCTTGTGGACTTTGGAAACATTGAAGAC
TGT
GTGGACCCAAAAGCACTCTGGGCCATTCCTTCTGAACTTCTGTCGGTTCCCATGCAAGCCTTTCCAT
GT
TGCCTCTCAGGGTTTAACATTTCAGAAGGATTATGTTCTCAAGAGGGAAATGACTATTTCTATGAAAT
A
ATAACAGAAGATGTGTTGGAAATAACAATACTAGAAATCAGAAGGGATGTTTGTGATATCCCTTTAGCA
ATT
GTTGACTTGAAAAGCAAAGGTAAAAGTATTAATGAGAAAATGGAGAAATATTCTAAGACTGGTATTA
AA
AGTGCTCTTCCCTATGAAAATATTGACTCAGAGATAAAGCAGACTCTTGGGTCCTACAATCTTGATGT
A
GGACTTAAGAAATTAAGTAATAAAGCTGTACAAAATAAAATATATATGGAACAACAGACAGATGAGCTT
GCT
GAAATAACTGAAAAAGATGTAAACATTATTGGAACCAAACCAAGTAACTTCCGTGACCCTAAAACTG
AT
AACATTTGTGAAGGGTTTGAAAACCCCTGCAAAGATAAAATTGATACTGAGGAACTGGAAGGTGAATT
A
GAGTGCCATCTGGTTGACAAAGCAGAGTTTGATGATAAATACCTGATTACAGGATTTAACACATTACTA
CCA
CATGCTAATGAAACAAAGGAGATACTAGAACTGAATTCACTTGAGGTGCCGCTTTCTCCTGATGATG
AA
TCAAAAGAATTCTTAGAACTGGAATCTATTGAGTTACAGAATTCTCTGGTGGTGGATGAAGAAAAAGG
G
GAGCTAAGCCCGGTGCCACCGAATGTGCCACTCTCCCAAGAGTGTGTCACAAAAGGCGCCATGGAGCTA
TTT
ACACTGCAGCTTCCTCTCAGCTGTGAAGCTGAGAAACAGCCAGAACTAGAACTACCTACAGCCCAGC
TG
CCTTTAGATGACAAGATGGATCCTTTGTCTTTAGGAGTTAGTCAGAAAGCACAGGAATCCATGTGTAC
T
GAGGACATGAGAAAGTCAAGTTGTGTAGAATCTTTTGATGACCAGCGCAGGATGTCATTGCATCTACAT
GGA
GCAGATTGTGATCCTAAAACACAGAATGAAATGAATATATGTGAAGAAGAATTTGTAGAGTATAAAA
AC
AGGGATGCCATTTCGGCATTGATGCCTTTGTTCTCTGAGGAAGAAAGCAGTGATGGAAGCAAGCACAA
T
AATGGTTTACCAGATCATATCTCAGCTCAACTACAGAACACCTACACTCTGAAAGCCTTTACTGTTGGA
TCT
AAATGTGTTGTGTGGTCAAGTCTAAGAAACACATGGTCTAAATGTGAGATTTTAGAAACAGCTGAAG
AA
GGAACAAGGAAAAGGGGTTTGGAGGTGATGGAGATTTAA


Translation (2066 aa):
MCSTPGMPAPGASLALRVSFVDVHPDVIPVQLWGLVGERRGEYLRLSREIQEAAATRGQWALGSASASPG
E
LCLVQVGLLWHRCRVVSRQAQESRVFLLDEGRTITAGAGSLAPGRREFFNLPSEVLGCVLAGLVPAGCG
A
GSGEPPQHWPADAVDFLSNLQGKEVHGCVLDVLLLHRLVLLEVPDVFQQMRELGLARRVPDSLFRSLLE
R
YLTAATASVGSGVPVLSRVPLKQKQPGLDYFYPQLQLGVTEAVVITQVCHPHRIHCQLRSVSQEIHRLS
E
SMAQVYRGSTGTGDENSTSATWEEREESPDKPGSPCASCGLDGHWYRALLLETFRPQRCAQVLHVDYGR
K
ELVSCSSLRYLLPEYFRMPVVTYPCALYGLWDGGRGWSRSQVGDLKTLILGKAVNAKIEFYCSFEHVYY
V
SLYGEDGINLNRVFGVQSCCLADRVLQSQATEEEEPETSQSQSPAEEVDEEISLPALRSIRLKMNAFYD
A
QVEFVKNPSEFWIRLRKHNVTFSKLMRRMCGFYSSASKLDGVVLKPEPDDLCCVKWKENGYYRAIVTKL
D
DKSVDVFLVDRGNSENVDWYDVRMLLPQFRQLPILAVKCTLADIWPLGKTWSQEAVSFFKKTVLHKELV
I
HILDKQDHQYVIEILDESRTGEENISKVIAQAGYAKYQEFETKENILVNAHSPGHVSNHFTTESNKIPF
A
KTGEGEQKAKRENKTTSVSKALSDTTVVTNGSTELVVQEKVKRASVYFPLMQNCLEIKPGSSSKGELEV
G
STVEVRVSYVENPGYFWCQLTRNIQGLKTLMSDIQYYCKNTAAPHQRNTLACLAKRTVNRQWSRALISG
I
QSVEHVNVTFVDYGDREMVSVKNIYSISEEFLKVKAQAFRCSLYNLIQPVGQNPFVWDVKAIQAFNEFI
D
NAWQKNLELKCTIFALASINEELFNIVDLLTPFQSACHFLVEKRLARPVKLQKPLESSVQLHSYFYSTH
D
MKIGSEELVYITHIDDPWTFYCQLARNANILEQLSCSITQLSKVLLNLKTSPLNPGTLCLAKYTDGNWY
R
GIVIEKEPKKVFFVDFGNIYVVTSDDLLPIPSDAYDVLLLPMQAVRCSLSDIPDHIPEEVVVWFQETIL
D
KSLKALVVAKDPDGTLIIELYGDNIQISASINKKLGLLSYKDRIRKKESEVLCSTTETLEEKNENMKLP
C
TEYLSKSVGYKLPNKEILEESYKPQINSSYKELKLLQSLTKTNLVTQYQDSVGNKNSQVFPLTTEKKEE
I
SAETPLKTARVEATLSERKIGDSCDKDLPLKFCEFPQKTIMPGFKTTVYVSHINDLSDFYVQLIEDEAE
I
SHLSERLNSVKTRPEYYVGPPLQRGDMICAVFPEDNLWYRAVIKEQQPNDLLSVQFIDYGNVSVVHTNK
I
GRLDLVNAILPGLCIHCSLQGFEVPDNKNSKKMMHYFSQRTSEAAIRCEFVKFQDRWEVILADEHGIIA
D
DMISRYALSEKSQVELSTQVIKSASSKSVNKSDIDTSVFLNWYNPEKKMIRAYATVIDGPEYFWCQFAD
T
EKLQCLEVEVQTAGEQVADRRNCIPCPYIGDPCIVRYREDGHYYRALITNICEDYLVSVRLVDFGNIED
C
VDPKALWAIPSELLSVPMQAFPCCLSGFNISEGLCSQEGNDYFYEIITEDVLEITILEIRRDVCDIPLA
I
VDLKSKGKSINEKMEKYSKTGIKSALPYENIDSEIKQTLGSYNLDVGLKKLSNKAVQNKIYMEQQTDEL
A
EITEKDVNIIGTKPSNFRDPKTDNICEGFENPCKDKIDTEELEGELECHLVDKAEFDDKYLITGFNTLL
P
HANETKEILELNSLEVPLSPDDESKEFLELESIELQNSLVVDEEKGELSPVPPNVPLSQECVTKGAMEL
F
TLQLPLSCEAEKQPELELPTAQLPLDDKMDPLSLGVSQKAQESMCTEDMRKSSCVESFDDQRRMSLHLH
G
ADCDPKTQNEMNICEEEFVEYKNRDAISALMPLFSEEESSDGSKHNNGLPDHIS
AQLQNTYTLKAFTVG
S
KCVVWSSLRNTWSKCEILETAEEGTR
KRGLEVMEI



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser