NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS55000.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
55000.1 Public Homo sapiens 6 PGC 24 110 108 CCDS HistoryNCBI Gene:5225Re-query CCDS DB by CCDS ID:55000.1Re-query CCDS DB by GeneID:5225See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 8, NCBI annotation release 37.2, Ensembl annotation release 62

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 55000.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000425343.6 ENSP00000405094.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000425343.6Link to Ensembl Protein Viewer:ENSP00000405094.2Re-query CCDS DB by Nucleotide ID:ENST00000425343Re-query CCDS DB by Protein ID:ENSP00000405094
Original member Current member NCBI NM_001166424.2 NP_001159896.1 Accepted alive Link to Nucleotide Sequence:NM_001166424.2Link to Protein Sequence:NP_001159896.1Re-query CCDS DB by Nucleotide ID:NM_001166424Re-query CCDS DB by Protein ID:NP_001159896Link to BLAST:NP_001159896.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001159896.1 315 P20142-2 315 100% 0 0

Chromosomal Locations for CCDS 55000.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 6 (NC_000006.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 41740975 41741227 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 41741796 41741843 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 41742290 41742489 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 41743271 41743389 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 41744397 41744514 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 41744658 41744808 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 41747276 41747334 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (948 nt):
ATGAAGTGGATGGTGGTGGTCTTGGTCTGCCTCCAGCTCTTGGAGGCAGCAGTGGTCAAAGTGCCCCTGA
AG
AAATTTAAGTCTATCCGTGAGACCATGAAGGAGAAGGGCTTGCTGGGGGAGTTCCTGAGGACCCACAA
G
TATGATCCTGCTTGGAAGTACCGCTTTGGTGACCTCAGCGTGACCTACGAGCCCATGGCCTACATGGAT
GCT
GCCTACTTTGGTGAGATCAGCATCGGGACTCCACCCCAGAACTTCCTGGTCCTTTTTGACACCGGCT
CC
TCCAACTTGTGGGTGCCCTCTGTCTACTGCCAGAGCCAGGCCTGCACCAGTCACTCCCGCTTCAACCC
C
AGCGAGTCGTCCACCTACTCCACCAATGGGCAGACCTTCTCCCTGCAGTATGGCAGTGGCAGCCTCACC
GGC
TTCTTTGGCTATGACACCCTGACTGTCCAGAGCATCCAGGTCCCCAACCAGGAGTTCGGCTTGAGTG
AG
AATGAGCCTGGTACCAACTTCGTCTATGCGCAGTTTGATGGCATCATGGGCCTGGCCTACCCTGCTCT
G
TCCGTGGATGAGGCCACCACAGCTATGCAGGGCATGGTGCAGGAGGGCGCCCTCACCAGCCCCGTCTTC
AGC
GTCTACCTCAGCAACCTGGTCCTGGAGTCTTCTGGTCTAGGTCCACTGCTGACCCCTAGCAGAGCAG
CT
CCACCCAGCTCCACACTCCAGCTACCAGAGAAGCCTCTGGAACAAACATGGAATATCCTTACCCCCTT
C
ACCAAGACCCTACCTGTCTCCAATCTCAGCAGAAAAGTAACAAGCTGGGCCGGGGTGGGGATCCCGGTG
ACA
TGTCTACCAGAGGCAGGAAGCGGAGGGGAGAGGAGAGCAGAGTGTGGGCTGGGGGTCCCAACCACTA
GG
GGACCCCCCAGAAGTCAGCATCATTCGGGAGCCTGA


Translation (315 aa):
MKWMVVVLVCLQLLEAAVVKVPLKKFKSIRETMKEKGLLGEFLRTHKYDPAWKYRFGDLSVTYEPMAYMD
A
AYFGEISIGTPPQNFLVLFDTGSSNLWVPSVYCQSQAC
TSHSRFNPSESSTYSTNGQTFSLQYGSGSLT
G
FFGYDTLT
VQSIQVPNQEFGLSENEPGTNFVYAQFDGIMGLAYPALSVDEATTAMQGMVQEGALTSPVF
S
VYLS
NLVLESSGLGPLLTPSRAAPPSSTLQLPEKPLEQTWNILTPFTKTLPVSNLSRKVTSWAGVGIPV
T
CLPEAGSGGERRAECGLGVPTTRGPPRSQHHSGA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser