NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Thursday, April 25, 2024, starting at 7:00 a.m. EDT for up to 120 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS54945.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
54945.1 Public Homo sapiens 5 WWC1 24 110 108 CCDS HistoryNCBI Gene:23286Re-query CCDS DB by CCDS ID:54945.1Re-query CCDS DB by GeneID:23286See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 8, NCBI annotation release 37.2, Ensembl annotation release 62

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 54945.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000521089.5 ENSP00000427772.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000521089.5Link to Ensembl Protein Viewer:ENSP00000427772.1Re-query CCDS DB by Nucleotide ID:ENST00000521089Re-query CCDS DB by Protein ID:ENSP00000427772
Original member Current member NCBI NM_001161661.2 NP_001155133.1 Accepted alive Link to Nucleotide Sequence:NM_001161661.2Link to Protein Sequence:NP_001155133.1Re-query CCDS DB by Nucleotide ID:NM_001161661Re-query CCDS DB by Protein ID:NP_001155133Link to BLAST:NP_001155133.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001155133.1 1119 Q8IX03-2 1119 100% 0 0

Chromosomal Locations for CCDS 54945.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 168292153 168292271 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 168371424 168371533 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 168385211 168385414 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 168397724 168397800 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 168399488 168399567 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 168406198 168406327 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 168408507 168408653 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 168409922 168409995 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 168414348 168414590 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 168422008 168422097 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 168423533 168424068 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 168428033 168428141 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 168428707 168428787 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 168430137 168430223 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 168431252 168431444 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 168441682 168441834 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 168444494 168444585 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 168453968 168454100 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 168455356 168455520 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 168460650 168460742 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 168464711 168464962 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 168467840 168467964 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 168468951 168469017 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3360 nt):
ATGCCCCGGCCGGAGCTGCCCCTGCCGGAGGGCTGGGAGGAGGCGCGCGACTTCGACGGCAAGGTCTACT
AC
ATAGACCACACGAACCGCACCACCAGCTGGATCGACCCGCGGGACAGGTACACCAAACCGCTCACCTT
T
GCTGACTGCATTAGTGATGAGTTGCCGCTAGGATGGGAAGAGGCATATGACCCACAGGTTGGAGATTAC
TTC
ATAGACCACAACACCAAAACCACTCAGATTGAGGATCCTCGAGTACAATGGCGGCGGGAGCAGGAAC
AT
ATGCTGAAGGATTACCTGGTGGTGGCCCAGGAGGCTCTGAGTGCACAAAAGGAGATCTACCAGGTGAA
G
CAGCAGCGCCTGGAGCTTGCACAGCAGGAGTACCAGCAACTGCATGCCGTCTGGGAGCATAAGCTGGGC
TCC
CAGGTCAGCTTGGTCTCTGGTTCATCATCCAGCTCCAAGTATGACCCTGAGATCCTGAAAGCTGAAA
TT
GCCACTGCAAAATCCCGGGTCAACAAGCTGAAGAGAGAGATGGTTCACCTCCAGCACGAGCTGCAGTT
C
AAAGAGCGTGGCTTTCAGACCCTGAAGAAAATCGATAAGAAAATGTCTGATGCTCAGGGCAGCTACAAA
CTG
GATGAAGCTCAGGCTGTCTTGAGAGAAACAAAAGCCATCAAAAAGGCTATTACCTGTGGGGAAAAGG
AA
AAGCAAGATCTCATTAAGAGCCTTGCCATGTTGAAGGACGGCTTCCGCACTGACAGGGGGTCTCACTC
A
GACCTGTGGTCCAGCAGCAGCTCTCTGGAGAGTTCGAGTTTCCCGCTACCGAAACAGTACCTGGATGTG
AGC
TCCCAGACAGACATCTCGGGAAGCTTCGGCATCAACAGCAACAATCAGTTGGCAGAGAAGGTCAGAT
TG
CGCCTTCGATATGAAGAGGCTAAGAGAAGGATCGCCAACCTGAAGATCCAGCTGGCCAAGCTTGACAG
T
GAGGCCTGGCCTGGGGTGCTGGACTCAGAGAGGGACCGGCTGATCCTTATCAACGAGAAGGAGGAGCTG
CTG
AAGGAGATGCGCTTCATCAGCCCCCGCAAGTGGACCCAGGGGGAGGTGGAGCAGCTGGAGATGGCCC
GG
AAGCGGCTGGAAAAGGACCTGCAGGCAGCCCGGGACACCCAGAGCAAGGCGCTGACGGAGAGGTTAAA
G
TTAAACAGTAAGAGGAACCAGCTTGTGAGAGAACTGGAGGAAGCCACCCGGCAGGTGGCAACTCTGCAC
TCC
CAGCTGAAAAGTCTCTCAAGCAGCATGCAGTCCCTGTCCTCAGGCAGCAGCCCCGGATCCCTCACGT
CC
AGCCGGGGCTCCCTGGTTGCATCCAGCCTGGACTCCTCCACTTCAGCCAGCTTCACTGACCTCTACTA
T
GACCCCTTTGAGCAGCTGGACTCAGAGCTGCAGAGCAAGGTGGAGTTCCTGCTCCTGGAGGGGGCCACC
GGC
TTCCGGCCCTCAGGCTGCATCACCACCATCCACGAGGATGAGGTGGCCAAGACCCAGAAGGCAGAGG
GA
GGTGGCCGCCTGCAGGCTCTGCGTTCCCTGTCTGGCACCCCAAAGTCCATGACCTCCCTATCCCCACG
T
TCCTCTCTCTCCTCCCCCTCCCCACCCTGTTCCCCTCTCATGGCTGACCCCCTCCTGGCTGGTGATGCC
TTC
CTCAACTCCTTGGAGTTTGAAGACCCGGAGCTGAGTGCCACTCTTTGTGAACTGAGCCTTGGTAACA
GC
GCCCAGGAAAGATACCGGCTGGAGGAACCAGGAACGGAGGGCAAGCAGCTGGGCCAAGCTGTGAATAC
G
GCCCAGGGGTGTGGCCTGAAAGTGGCCTGTGTCTCAGCCGCCGTATCGGACGAGTCAGTGGCTGGAGAC
AGT
GGTGTGTACGAGGCTTCCGTGCAGAGACTGGGTGCTTCAGAAGCTGCTGCATTTGACAGTGACGAAT
CG
GAAGCAGTGGGTGCGACCCGAATTCAGATTGCCCTGAAGTATGATGAGAAGAATAAGCAATTTGCAAT
A
TTAATCATCCAGCTGAGTAACCTTTCTGCTCTGTTGCAGCAACAAGACCAGAAAGTGAATATCCGCGTG
GCT
GTCCTTCCTTGCTCTGAAAGCACAACCTGCCTGTTCCGGACCCGGCCTCTGGACGCCTCAGACACTC
TA
GTGTTCAATGAGGTGTTCTGGGTATCCATGTCCTATCCAGCCCTTCACCAGAAGACCTTAAGAGTCGA
T
GTCTGTACCACCGACAGGAGCCATCTGGAAGAGTGCCTGGGAGGCGCCCAGATCAGCCTGGCGGAGGTC
TGC
CGGTCTGGGGAGAGGTCGACTCGCTGGTACAACCTTCTCAGCTACAAATACTTGAAGAAACAGAGCA
GG
GAGCTCAAGCCAGTGGGAGTCATGGCCCCTGCCTCAGGGCCTGCCAGCACGGACGCTGTGTCTGCTCT
G
TTGGAACAGACAGCAGTGGAGCTGGAGAAGAGGCAGGAGGGCAGGAGCAGCACACAGACACTGGAAGAC
AGC
TGGAGGTATGAGGAGACCAGTGAGAATGAGGCAGTAGCCGAGGAAGAGGAGGAGGAGGTGGAGGAGG
AG
GAGGGAGAAGAGGATGTTTTCACCGAGAAAGCCTCACCTGATATGGATGGGTACCCAGCATTAAAGGT
G
GACAAAGAGACCAACACGGAGACCCCGGCCCCATCCCCCACAGTGGTGCGACCTAAGGACCGGAGAGTG
GGC
ACCCCGTCCCAGGGGCCATTTCTTCGAGGGAGCACCATCATCCGCTCTAAGACCTTCTCCCCAGGAC
CC
CAGAGCCAGTACGTGTGCCGGCTGAATCGGAGTGATAGTGACAGCTCCACTCTGTCCAAAAAGCCACC
T
TTTGTTCGAAACTCCCTGGAGCGACGCAGCGTCCGGATGAAGCGGCCGTCCCCACCCCCACAGCCTTCC
TCG
GTCAAGTCGCTGCGCTCCGAGCGTCTGATCCGTACCTCGCTGGACCTGGAGTTAGACCTGCAGGCGA
CA
AGAACCTGGCACAGCCAATTGACCCAGGAGATCTCGGTGCTGAAGGAGCTCAAGGAGCAGCTGGAACA
A
GCCAAGAGCCACGGGGAGAAGGAGCTGCCACAGTGGTTGCGTGAGGACGAGCGTTTCCGCCTGCTGCTG
AGG
ATGCTGGAGAAGCGGCAGATGGACCGAGCGGAGCACAAGGGTGAGCTTCAGACAGACAAGATGATGA
GG
GCAGCTGCCAAGGATGTGCACAGGCTCCGAGGCCAGAGCTGTAAGGAACCCCCAGAAGTTCAGTCTTT
C
AGGGAGAAGATGGCATTTTTCACCCGGCCTCGGATGAATATCCCAGCTCTCTCTGCAGATGACGTCTAA


Translation (1119 aa):
MPRPELPLPEGWEEARDFDGKVYYIDHTNRTTSWIDPRDRYTKPLTFADCISDELPLGWEEAYDPQVGDY
F
IDHNT
KTTQIEDPRVQWRREQEHMLKDYLVVAQEALSAQKEIYQVKQQRLELAQQEYQQLHAVWEHKLG
S
QVS
LVSGSSSSSKYDPEILKAEIATAKSRVNKLKREMVHLQHELQFKERGFQTLKKIDKKMSDAQGSYK
L
DEAQAVLRETKAIKKAITCGEKEKQDLIK
SLAMLKDGFRTDRGSHSDLWSSSSSLESSSFPLPKQYLDV
S
SQTDISGS
FGINSNNQLAEKVRLRLRYEEAKRRIANLKIQLAKLDSEAWPGVLDSERDRLILINEKEEL
L
KEMRFISPRKWTQGEVEQLEMARKRLEKDLQAARDTQSKALTE
RLKLNSKRNQLVRELEEATRQVATLH
S
QLK
SLSSSMQSLSSGSSPGSLTSSRGSLVASSLDSSTSASFTDLYYDPFEQLDSELQSKVEFLLLEGAT
G
FRPSGCITTIHEDEVAKTQKAEGGGRLQALRSLSGTPKSMTSLSPRSSLSSPSPPCSPLMADPLLAGDA
F
LNSLEFEDPELSATLCELSLGNSAQERYRLEEPGTEGKQLGQ
AVNTAQGCGLKVACVSAAVSDESVAGD
S
GVYEASVQ
RLGASEAAAFDSDESEAVGATRIQIALKYDEKNKQFAILIIQLSNLSALLQQQDQKVNIRV
A
VLPCSESTTCLFRTRPLDASDTLVFNEVFWVSMSYPALHQKTLRVDVCTTDRSHLEECL
GGAQISLAEV
C
RSGERSTRWYNLLSYKYLKKQSRELKPVGVMAPASGPAST
DAVSALLEQTAVELEKRQEGRSSTQTLED
S
WRYEETSENEAVAEEEEEEVEEEEGEEDVFTEKASPDMDGYPALKVDKETNTETPAPSPTVVRPKDRRV
G
TPSQGPFLRGSTIIRSKTFSPGPQSQYVCR
LNRSDSDSSTLSKKPPFVRNSLERRSVRMKRPSPPPQPS
S
VKSLRSERLIRTSLDLELDLQATRTWHSQLTQEISVLKELKEQLEQAKSHGEKELPQWLREDERFRLLL
R
MLEKR
QMDRAEHKGELQTDKMMRAAAKDVHRLRGQSCKEPPEVQSFREKMAFFTRPRMNIPALSADDV



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser