NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS54772.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
54772.1 Public Homo sapiens 4 FRAS1 22 109 92 CCDS HistoryNCBI Gene:80144Re-query CCDS DB by CCDS ID:54772.1Re-query CCDS DB by GeneID:80144See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 8, NCBI annotation release 37.2, Ensembl annotation release 62

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 54772.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000325942.10 ENSP00000326330.6 Accepted alive Link to Ensembl Transcript Viewer:ENST00000325942.10Link to Ensembl Protein Viewer:ENSP00000326330.6Re-query CCDS DB by Nucleotide ID:ENST00000325942Re-query CCDS DB by Protein ID:ENSP00000326330
Original member Current member NCBI NM_001166133.1 NP_001159605.1 Accepted alive Link to Nucleotide Sequence:NM_001166133.1Link to Protein Sequence:NP_001159605.1Re-query CCDS DB by Nucleotide ID:NM_001166133Re-query CCDS DB by Protein ID:NP_001159605Link to BLAST:NP_001159605.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001159605.1 1976 Q86XX4-5 1976 100% 0 0

Chromosomal Locations for CCDS 54772.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 78058010 78058085 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78065985 78066016 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78237510 78237617 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78245233 78245325 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78252392 78252551 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78255242 78255375 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78265025 78265108 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78266834 78266935 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78267241 78267432 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78278655 78278744 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78281398 78281433 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78282820 78282967 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78284405 78284548 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78286405 78286539 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78308066 78308209 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78315594 78315734 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78317368 78317508 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78318810 78318986 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78333272 78333412 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78337674 78337817 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78363513 78363665 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78363908 78364054 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78369838 78369984 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78372718 78372858 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78374111 78374251 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78375739 78375879 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78379726 78379996 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78384059 78384143 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78387375 78387701 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78400734 78400887 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78407663 78407841 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78412969 78413085 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78418949 78419063 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78421863 78422000 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78424388 78424420 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78429095 78429226 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78430292 78430417 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78432357 78432604 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78438570 78438718 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78438902 78439064 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78441162 78441297 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 78445522 78445787 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5931 nt):
ATGGGTGTCCTCAAAGTGTGGCTCGGGCTGGCCCTAGCGTTGGCGGAATTTGCAGTATTGCCTCATCATT
CC
GAAGGTGCTTGTGTCTATCAGGATTCCTTGTTGGCGGATGCCACAATTTGGAAGCCCGATTCATGCCA
G
AGCTGCCGTTGCCATGGTGATATTGTTATCTGCAAACCTGCTGTTTGCAGAAACCCTCAATGTGCCTTT
GAG
AAGGGAGAAGTGCTTCAAATAGCTGCCAACCAATGCTGTCCTGAGTGTGTTTTGAGGACTCCAGGAT
CT
TGCCATCATGAAAAGAAAATCCATGAGCATGGGACAGAATGGGCCTCTTCTCCATGTAGTGTGTGCTC
T
TGCAATCATGGGGAAGTCCGATGTACCCCCCAACCATGCCCACCGCTGTCATGTGGACACCAGGAGCTG
GCA
TTCATCCCTGAAGGAAGCTGCTGCCCAGTTTGTGTGGGCCTTGGGAAACCCTGTTCCTATGAAGGCC
AT
GTGTTTCAGGATGGGGAGGACTGGCGGCTGAGCCGGTGTGCCAAATGTCTGTGTAGAAATGGGGTTGC
C
CAGTGCTTCACAGCTCAGTGTCAGCCTCTATTTTGTAACCAGGATGAGACTGTAGTCCGAGTCCCTGGA
AAA
TGTTGCCCGCAGTGCTCTGCAAGATCCTGCTCTGCAGCTGGCCAAGTATACGAGCATGGTGAGCAGT
GG
AGCGAAAATGCCTGCACCACGTGTATATGTGACCGGGGTGAGGTCAGGTGTCACAAGCAGGCCTGCCT
G
CCCCTGAGATGCGGAAAGGGTCAGAGCAGGGCTCGGCGTCATGGGCAATGCTGTGAGGAATGTGTGTCT
CCT
GCCGGGAGCTGCTCCTATGATGGAGTTGTGCGGTACCAGGACGAAATGTGGAAGGGCTCGGCCTGTG
AG
TTCTGCATGTGTGATCATGGCCAAGTGACCTGCCAGACTGGAGAGTGTGCCAAAGTGGAGTGTGCCCG
G
GATGAAGAATTAATTCACTTAGATGGAAAGTGTTGTCCTGAATGCATTTCAAGGAATGGTTATTGTGTT
TAT
GAAGAAACTGGAGAATTTATGTCATCAAATGCTAGTGAAGTTAAACGTATTCCAGAGGGAGAGAAGT
GG
GAAGATGGCCCTTGCAAGGTGTGTGAGTGCCGAGGGGCTCAGGTAACTTGCTACGAGCCCTCTTGCCC
A
CCATGTCCAGTGGGCACACTGGCCTTAGAGGTGAAGGGACAGTGCTGTCCAGACTGCACATCAGTTCAT
TGC
CATCCAGATTGTTTGACATGCTCTCAGTCTCCAGACCACTGTGACCTCTGCCAAGATCCTACCAAGT
TA
CTGCAGAATGGATGGTGTGTGCACAGCTGTGGACTGGGTTTTTACCAAGCTGGCAGTCTCTGTTTAGC
C
TGCCAGCCCCAGTGCTCCACGTGTACCAGTGGGCTGGAGTGCTCATCCTGCCAGCCTCCCCTGCTGATG
CGG
CACGGGCAGTGTGTGCCTACCTGTGGGGACGGCTTCTACCAAGATCGCCATTCCTGTGCAGTCTGCC
AT
GAGTCCTGTGCAGGTTGCTGGGGCCCAACGGAGAAGCACTGCTTGGCCTGCAGAGATCCCCTCCACGT
G
CTGAGAGATGGCGGCTGTGAGAGCAGCTGTGGAAAAGGCTTCTACAACAGGCAGGGCACCTGTAGCGCT
TGT
GACCAATCCTGTGACAGTTGTGGCCCCAGTAGCCCCAGGTGTCTTACCTGTACTGAGAAGACAGTGC
TG
CATGATGGGAAATGCATGTCTGAATGCCCTGGCGGGTACTATGCTGATGCCACTGGCAGGTGCAAAGT
T
TGTCATAACTCATGTGCCAGCTGCTCTGGGCCCACACCCTCTCACTGTACAGCCTGCAGCCCCCCCAAG
GCT
CTGCGTCAAGGCCACTGTCTGCCCCGCTGTGGAGAGGGTTTCTACTCTGACCATGGAGTCTGCAAAG
CC
TGTCACTCCTCCTGCCTGGCTTGTATGGGTCCCGCACCCTCTCACTGTACTGGGTGTAAGAAGCCAGA
G
GAAGGACTGCAAGTGGAGCAGCTGTCTGACGTGGGCATCCCCTCTGGCGAGTGTCTAGCCCAGTGTAGA
GCC
CATTTTTACTTGGAGAGCACTGGCATATGTGAAGCTTGCCACCAGTCCTGTTTCAGATGTGCAGGGA
AA
AGCCCACATAACTGCACAGACTGTGGGCCTTCCCATGTGCTGTTGGATGGGCAGTGCCTCTCCCAGTG
C
CCAGATGGCTACTTTCACCAGGAAGGTAGTTGCACAGAGTGTCACCCAACCTGCAGGCAGTGTCATGGG
CCG
TTGGAGTCTGACTGCATCTCCTGTTACCCTCACATCTCTCTTACCAATGGTAACTGCAGGACCAGCT
GC
AGGGAAGAGCAGTTCCTCAACCTCGTGGGATACTGTGCTGACTGCCATCACCTGTGCCAGCACTGTGC
A
GCTGATCTCCACAACACTGGGAGCATCTGCCTCAGGTGCCAGAATGCCCACTACCTGCTGCTCGGGGAC
CAC
TGTGTTCCTGACTGCCCTTCAGGATACTATGCAGAGAGAGGAGCTTGTAAAAAATGCCACTCCTCCT
GC
AGAACCTGCCAGGGCAGAGGACCTTTCTCCTGCTCCTCATGTGACACCAACCTCGTGCTGTCCCACAC
T
GGCACCTGCAGCACCACCTGCTTCCCTGGGCACTATCTTGATGACAATCATGTTTGCCAGCCATGCAAC
ACA
CACTGTGGAAGCTGTGATTCACAGGCCAGCTGTACCTCCTGCCGAGATCCAAACAAGGTTCTGCTCT
TT
GGGGAATGTCAATACGAGAGCTGCGCCCCACAGTACTATCTTGACTTCTCCACCAACACGTGCAAAGA
G
TGTGATTGGAGCTGCAGTGCATGCAGTGGGCCCCTGAAAACAGACTGCCTGCAGTGCATGGATGGCTAT
GTT
CTCCAGGATGGGGCCTGCGTGGAGCAGTGCTTGTCATCATTTTACCAGGACTCGGGCCTCTGCAAGA
AC
TGTGACAGCTACTGTCTCCAGTGCCAAGGTCCCCATGAGTGTACCCGCTGCAAAGGGCCATTTCTCCT
C
TTGGAAGCCCAGTGTGTCCAGGAATGTGGGAAGGGGTACTTTGCAGATCATGCAAAGCACAAATGCACA
G
CC
TGCCCTCAGGGGTGCTTGCAGTGCAGCCACAGGGACCGTTGTCACCTCTGTGACCATGGGTTCTTTC
TG
AAGAGTGGCCTCTGTGTTTACAACTGTGTTCCTGGCTTTTCTGTCCACACCTCTAATGAAACATGTTC
T
GGCAAAATACACACCCCTAGTCTTCATGTGAATGGTTCCCTGATCCTCCCAATTGGTTCAATAAAGCCA
CTG
GATTTTTCCCTCCTGAATGTCCAAGACCAGGAGGGTAGGGTCGAAGATCTCCTATTTCATGTTGTGA
GC
ACTCCCACCAATGGTCAGCTAGTGCTCTCAAGAAATGGAAAAGAGGTTCAGCTGGACAAGGCTGGCCG
T
TTTAGCTGGAAAGATGTGAACGAGAAGAAAGTGCGTTTTGTGCACAGCAAAGAAAAACTCAGGAAAGGT
TAC
CTTTTCCTGAAAATTAGTGACCAGCAGTTCTTCTCTGAGCCACAGCTGATCAACATACAAGCATTTT
CA
ACACAGGCCCCCTATGTGCTGAGAAATGAAGTTCTCCACATTAGCAGAGGAGAGAGGGCAACCATCAC
C
ACCCAGATGCTTGACATCCGAGATGATGACAACCCACAGGATGTGGTCATTGAAATAATCGATCCTCCA
CTT
CATGGCCAATTGCTTCAGACACTTCAGTCCCCGGCAACCCCTATCTATCAATTCCAGCTGGATGAAC
TC
TCTAGAGGCCTTCTCCACTATGCTCATGATGGTTCAGACAGCACATCCGATGTTGCAGTCTTGCAGGC
C
AATGATGGACACTCCTTCCATAATATACTGTTCCAAGTGAAGACCGTGCCTCAGAATGACAGGGGTCTT
CAG
CTTGTGGCTAATTCGATGGTGTGGGTTCCAGAAGGGGGGATGCTGCAGATCACCAACAGAATCTTAC
AG
GCCGAGGCTCCTGGTGCCAGTGCTGAAGAAATCATCTACAAGATTACACAAGACTACCCCCAGTTTGG
G
GAGGTGGTCCTTCTAGTGAATATGCCTGCAGACAGCCCTGCAGATGAAGGGCAGCACCTGCCTGATGGG
AGG
ACAGCTACCCCCACCAGCACCTTCACCCAGCAGGACATCAATGAAGGCATCGTATGGTACAGGCACT
CA
GGAGCCCCAGCCCAGAGCGACTCCTTCCGCTTCGAGGTGTCCAGTGCCTCCAATGCCCAGACCCGCCT
G
GAGAGCCACATGTTCAACATCGCGATCTTACCACAGACACCTGAAGCACCTAAAGTGTCTCTGGAAGCA
TCT
CTCCATATGACTGCTAGAGAAGATGGCCTGACTGTTATTCAGCCTCATTCCCTCTCCTTCATAAACT
CT
GAGAAGCCAAGTGGAAAGATTGTCTACAACATCACTCTACCTCTGCATCCAAATCAAGGTATCATCGA
G
CACCGGGACCACCCTCACTCTCCTATCCGGTATTTCACGCAAGAGGATATTAACCAGGGCAAAGTCATG
TAC
CGCCCTCCCCCGGCAGCACCCCACCTCCAGGAGCTCATGGCCTTCTCGTTCGCTGGTCTCCCAGAAT
CA
GTGAAATTCCACTTCACAGTTTCAGATGGAGAACACACAAGTCCGGAGATGGTCCTCACCATTCACTT
A
CTTCCCAGTGATCAGCAACTGCCAGTGTTCCAGGTCACAGCTCCACGGCTGGCGGTCAGCCCAGGAGGC
AGC
ACTTCTGTAGGACTTCAGGTGGTAGTAAGAGATGCTGAGACAGCGCCCAAAGAACTCTTCTTTGAGC
TT
CGGAGACCTCCACAGCATGGTGTGCTTCTTAAGCATACAGCTGAGTTCCGAAGGCCGATGGCCACAGG
T
GACACTTTCACCTATGAGGATGTTGAGAAAAATGCTCTACAGTATATACATGATGGTTCCTCTACCCGG
GAA
GACAGCATGGAGATCTCAGTCACAGATGGCCTCACAGTGACAATGCTGGAGGTGAGAGTAGAGGTGT
CC
CTGTCAGAAGACCGAGGGCCTCGACTGGCTGCTGGCTCCTCTCTGAGCATTACTGTTGCCAGTAAAAG
C
ACAGCCATAATCACTAGGTCACACCTTGCTTACGTGGATGATTCTTCCCCCGACCCAGAGATCTGGATT
CAG
TTAAATTATCTGCCCTCATATGGTACTCTCTTAAGAATCTCAGGATCTGAGGTGGAAGAGCTCTCAG
AA
GTTTCCAATTTCACAATGGAAGACATCAATAACAAGAAAATCAGATACTCAGCTGTGTTTGAAACTGA
T
GGTCATCTGGTTACTGATAGCTTCTATTTCTCTGTCTCTGACATGGACCACAACCATCTGGATAATCAG
ATA
TTTACCATCATGATCACTCCTGCTGAAAATCCACCTCCAGTCATTGCTTTTGCTGACCTTATCACGG
TT
GATGAGGGAGGGAGAGCACCACTCTCATTTCACCATTTTTTTGCTACTGATGATGATGACAACCTCCA
G
AGAGATGCCATCATTAAACTAAGTGCTCTGCCCAAATATGGCTGCATTGAGAACACAGGAACAGGTGAT
CGT
TTTGGCCCTGAAACTGCCAGTGACCTAGAGGCATCATTTCCTATTCAAGACGTCCTGGAAAACTACA
TT
TACTACTTTCAGAGTGTTCATGAAAGCATTGAGCCAACCCATGATATTTTTAGTTTTTATGTGAGTGA
T
GGAACCAGTCGTTCAGAAATTCACAGCATCAATATCACCATTGAGGTAAAGACTTTGGAAGTTGGAAAG
GTT
GAGCCCTTGACCACAATATTTCACACCATTAGAGAGCTTTCTTTATAG


Translation (1976 aa):
MGVLKVWLGLALALAEFAVLPHHSEGACVYQDSLLADATIWKPDSCQSCRCHGDIVICKPAVCRNPQCAF
E
K
GEVLQIAANQCCPECVLRTPGSCHHEKKIHEHGTEWASSPCSVCSCNHGEVRCTPQPCPPLSCGHQEL
A
FIPEGSCCPVCVGLG
KPCSYEGHVFQDGEDWRLSRCAKCLCRNGVAQCFTAQCQPLFCNQDETVVRVPG
K
CCPQCSARSCSAAGQVYE
HGEQWSENACTTCICDRGEVRCHKQACLPLRCGKGQSRARRHGQCCEECVS
P
AGSCSYDGVVRYQDEMWKGSACEFCMCDHGQVTCQTGECAKVECAR
DEELIHLDGKCCPECISRNGYCV
Y
EETGEF
MSSNASEVKRIPEGEKWEDGPCKVCECRGAQVTCYEPSCPPCPVGTLALEVKGQCCPDCTSVH
C
HPDCLTCSQSPDHCDLCQDPTKLLQNGWCVHSCGLGFYQAGSLCL
ACQPQCSTCTSGLECSSCQPPLLM
R
HGQCVPTCGDGFYQDRHSCA
VCHESCAGCWGPTEKHCLACRDPLHVLRDGGCESSCGKGFYNRQGTCSA
C
DQSCDSCGPSSPRCLTCTEKTVLHDGKCMSECPGGYYADATGRCK
VCHNSCASCSGPTPSHCTACSPPK
A
LRQGHCLPRCGEGFYSDHGVCK
ACHSSCLACMGPAPSHCTGCKKPEEGLQVEQLSDVGIPSGECLAQCR
A
HFYLESTGICE
ACHQSCFRCAGKSPHNCTDCGPSHVLLDGQCLSQCPDGYFHQEGSCTECHPTCRQCHG
P
LESDCISCYPHISLTNGNCRTSCREEQFLNLVGYCA
DCHHLCQHCAADLHNTGSICLRCQNAHYLLLGD
H
CVPDCPSGYYAERGACK
KCHSSCRTCQGRGPFSCSSCDTNLVLSHTGTCSTTCFPGHYLDDNHVCQPCN
T
HCGSCDSQASCTSCRDPNKVLLFGECQYESCAPQYYLDFSTNTCK
ECDWSCSACSGPLKTDCLQCMDGY
V
LQDGACVEQCLSSFYQDSGLCK
NCDSYCLQCQGPHECTRCKGPFLLLEAQCVQECGKGYFADHAKHKCT
A
CPQGCLQCSHRDRCHLCDHGFFLKSGLCVYNCVPGFSVHTSNETCSGKIHTPSLHVNGSLILPIGSIKP
L
DFSLLNVQDQEGRVEDLLFHVVSTPTNGQLVLSRNGKEVQLDKAGRFSWKDVNEKKVRFVHSKEKL
RKG
Y
LFLKISDQQFFSEPQLINIQAFSTQ
APYVLRNEVLHISRGERATITTQMLDIRDDDNPQDVVIEIIDPP
L
HGQLLQTLQSPATPIYQFQLDELSRGLLHYAHDGSDSTSDVAVLQANDGHSFHNILFQVKTVPQ
NDRGL
Q
LVANSMVWVPEGGMLQITNRILQAEAPGASAEEIIYKITQDYPQF
GEVVLLVNMPADSPADEGQHLPDG
R
TATPTSTFTQQDINEGIVWYRHSGAPAQSDSFRFE
VSSASNAQTRLESHMFNIAILPQTPEAPKVSLEA
S
LHMT
AREDGLTVIQPHSLSFINSEKPSGKIVYNITLPLHPNQGIIEHRDHPHSPIRYFTQEDINQGKVM
Y
RPPPAAPHLQELMAFSFA
GLPESVKFHFTVSDGEHTSPEMVLTIHLLPSDQQLPVFQVTAPRLAVSPGG
S
TSV
GLQVVVRDAETAPKELFFELRRPPQHGVLLKHTAEFRRPMATGDTFTYEDVEKNALQYIHDGSSTR
E
DSMEISVTDGLTVTMLEVRVEVSLSEDRGPRLAAGSSLSITVASKSTAIITRSHLAYV
DDSSPDPEIWI
Q
LNYLPSYGTLLRISGSEVEELSEVSNFTMEDINNKKI
RYSAVFETDGHLVTDSFYFSVSDMDHNHLDNQ
I
FTIMITPAENPPPVIAFADLIT
VDEGGRAPLSFHHFFATDDDDNLQRDAIIKLSALPKYGCIENTGTGD
R
FGPETASDLEASFPIQDVLENYIYYFQSVHESIEPTHDIFSFYVSDGTSRSEIHSINITIEVKTLEVGK
V
EPLTTIFHTIRELSL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser