NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS54483.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
54483.1 Public Homo sapiens 21 SYNJ1 22 109 92 CCDS HistoryNCBI Gene:8867Re-query CCDS DB by CCDS ID:54483.1Re-query CCDS DB by GeneID:8867See the combined annotation on chromosome 21 in Sequence Viewer

Public since: CCDS release 8, NCBI annotation release 37.2, Ensembl annotation release 62

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 54483.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000357345.7 ENSP00000349903.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000357345.7Link to Ensembl Protein Viewer:ENSP00000349903.3Re-query CCDS DB by Nucleotide ID:ENST00000357345Re-query CCDS DB by Protein ID:ENSP00000349903
Original member Current member NCBI NM_001160302.1 NP_001153774.1 Accepted alive Link to Nucleotide Sequence:NM_001160302.1Link to Protein Sequence:NP_001153774.1Re-query CCDS DB by Nucleotide ID:NM_001160302Re-query CCDS DB by Protein ID:NP_001153774Link to BLAST:NP_001153774.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001153774.1 1295 O43426-4 1295 100% 0 0

Chromosomal Locations for CCDS 54483.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 21 (NC_000021.9)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21See the combined annotation on chromosome 21 in Sequence Viewer

Chromosome Start Stop Links
21 32634864 32634884 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32638908 32639125 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32639671 32639779 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32641896 32641966 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32642095 32642133 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32644968 32645006 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32645646 32645789 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32646393 32646602 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32650184 32650346 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32653288 32653366 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32656687 32656902 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32657003 32657120 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32657716 32657872 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32664913 32665071 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32665943 32666135 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32666433 32666573 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32670288 32670372 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32673340 32673531 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32676332 32676355 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32678645 32678801 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32681496 32681648 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32684038 32684119 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32685748 32685917 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32686978 32687074 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32688306 32688367 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32694228 32694311 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32695057 32695282 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32699838 32700105 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32701961 32702047 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 32726772 32726895 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3888 nt):
ATGGCGTTCAGTAAAGGATTCCGGATCTATCACAAATTGGATCCCCCACCTTTCAGCCTCATAGTGGAAA
CT
AGGCATAAGGAAGAATGTCTCATGTTCGAGTCTGGGGCTGTCGCTGTGCTCTCATCTGCAGAAAAAGA
G
GCAATCAAGGGTACATACTCCAAAGTACTGGATGCATATGGACTCTTAGGTGTTCTGCGGTTAAATCTT
G
GT
GATACTATGTTACATTATCTGGTCCTAGTCACTGGATGTATGTCTGTTGGAAAAATTCAAGAATCTG
AA
GTTTTCCGAGTTACTTCCACTGAGTTTATATCACTGCGAATCGATTCTTCAGATGAGGATCGCATTTC
A
GAAGTGCGGAAAGTTTTGAATTCAGGAAACTTTTATTTTGCATGGTCTGCATCTGGCATCAGTTTAGAT
TTG
AGTCTTAATGCGCATCGTAGCATGCAAGAACAGACAACTGATAATAGATTTTTCTGGAATCAGTCTT
TG
CATTTGCATCTCAAACACTATGGCGTGAATTGTGATGACTGGTTATTACGTCTTATGTGTGGAGGAGT
A
GAAATCAGAACAATTTATGCTGCTCATAAACAGGCGAAGGCTTGCCTCATTTCAAGATTAAGCTGTGAA
CGA
GCTGGGACCAGGTTTAATGTCCGGGGAACAAATGATGATGGTCATGTTGCCAATTTTGTAGAAACAG
AA
CAGGTTGTGTACTTAGATGACTCAGTTTCTTCCTTCATACAAATCCGAGGATCTGTTCCATTGTTCTG
G
GAGCAACCAGGGTTGCAAGTGGGATCTCATCGTGTCCGTATGTCAAGGGGATTTGAAGCCAATGCACCT
GCT
TTTGACAGGCATTTTAGAACACTTAAGAACTTATATGGTAAACAAATAATAGTAAATTTGCTTGGAT
CT
AAGGAAGGTGAACATATGCTAAGTAAAGCTTTCCAGAGTCATTTGAAAGCTTCTGAACATGCTGCTGA
T
ATCCAGATGGTGAATTTTGACTATCATCAAATGGTTAAGGGAGGAAAGGCAGAAAAATTACATAGTGTT
CTT
AAACCTCAAGTCCAGAAGTTTCTAGATTATGGATTTTTTTATTTCAATGGAAGTGAAGTTCAAAGAT
GC
CAGAGTGGTACAGTTCGAACAAACTGCTTGGATTGTCTTGATAGAACAAATAGTGTGCAGGCATTTCT
T
GGCTTAGAGATGCTAGCTAAACAGTTGGAAGCTCTTGGTTTAGCTGAAAAGCCTCAGTTGGTGACTCGC
TTT
CAAGAAGTTTTTCGGTCAATGTGGTCCGTGAATGGTGATTCAATCAGTAAGATATATGCAGGAACTG
GA
GCTCTTGAAGGGAAAGCGAAGTTAAAAGATGGTGCTCGCTCTGTTACCCGAACAATTCAGAATAACTT
C
TTTGACAGCTCCAAGCAAGAGGCCATTGATGTTTTGCTACTGGGAAATACTCTGAATAGTGATTTAGCT
GAC
AAAGCTCGAGCACTTTTAACTACTGGAAGTTTGCGTGTTTCTGAGCAGACATTACAGTCAGCATCTT
CT
AAAGTACTAAAGAGCATGTGTGAGAATTTCTACAAATATTCAAAGCCTAAGAAAATTCGAGTATGTGT
C
GGAACCTGGAATGTGAATGGTGGGAAGCAATTTCGCAGCATAGCTTTTAAGAATCAGACACTCACTGAC
TGG
CTTCTTGATGCACCCAAGTTAGCTGGCATCCAGGAGTTTCAAGATAAAAGAAGTAAGCCAACTGATA
TA
TTTGCAATTGGTTTTGAAGAAATGGTAGAATTGAATGCTGGAAACATTGTGAGTGCAAGCACAACAAA
T
CAGAAGCTCTGGGCTGTAGAACTTCAGAAGACAATCTCCAGAGACAACAAGTATGTGCTGCTGGCTTCT
GAA
CAGTTGGTGGGCGTCTGTTTGTTTGTTTTTATCAGACCACAGCATGCTCCTTTTATCAGGGATGTTG
CA
GTTGATACTGTGAAGACTGGAATGGGAGGTGCAACTGGAAATAAGGGAGCAGTTGCAATCCGAATGCT
C
TTCCATACAACCAGCCTTTGCTTCGTCTGTAGCCACTTTGCTGCAGGGCAGTCACAAGTCAAAGAAAGA
AAT
GAAGATTTTATAGAAATAGCACGAAAATTGAGTTTTCCTATGGGAAGGATGCTATTTTCCCATGACT
AT
GTATTTTGGTGTGGTGATTTCAACTATCGAATCGATCTCCCTAACGAAGAAGTTAAAGAGCTCATAAG
A
CAGCAAAATTGGGATTCTCTTATAGCAGGAGATCAACTTATCAATCAGAAAAATGCTGGACAGGTTTTT
AGA
GGATTTTTAGAAGGAAAGGTAACCTTTGCTCCGACATATAAGTATGACTTGTTTTCTGACGACTATG
AC
ACCAGTGAAAAGTGCCGCACCCCTGCCTGGACAGACCGTGTCCTTTGGAGAAGGAGGAAATGGCCTTT
T
GATAGATCAGCTGAAGATCTAGATCTTCTAAATGCTAGTTTTCAAGATGAAAGCAAAATTCTGTACACG
TGG
ACTCCAGGCACTTTGCTGCACTATGGAAGAGCTGAGCTGAAGACTTCTGACCACAGGCCTGTCGTTG
CC
CTGATTGATATAGATATATTTGAAGTTGAAGCTGAAGAGAGGCAAAACATTTATAAAGAAGTAATTGC
A
GTTCAGGGTCCACCAGATGGTACAGTATTGGTCTCAATCAAAAGTTCTTTACCAGAAAATAATTTTTTT
GAT
GATGCCTTGATTGATGAGCTTCTGCAGCAGTTTGCAAGTTTTGGTGAAGTTATACTTATAAGATTTG
TA
GAAGATAAAATGTGGGTTACATTTTTGGAGGGAAGCTCTGCCTTGAATGTTCTGAGCCTAAATGGTAA
A
GAGTTATTGAATCGGACTATAACTATTGCTTTAAAAAGTCCAGACTGGATCAAAAATTTGGAAGAAGAA
ATG
AGTTTAGAGAAAATTAGCATTGCATTGCCATCATCAACAAGCTCTACCCTGCTTGGTGAAGATGCAG
AG
GTTGCAGCAGATTTTGATATGGAAGGTGATGTTGATGACTATAGTGCTGAAGTGGAGGAACTTCTTCC
T
CAGCATCTCCAGCCATCTTCAAGTTCCGGCCTTGGTACTTCCCCCAGCTCTTCACCCCGAACTAGTCCC
TGC
CAGTCACCTACAATATCAGAGGGTCCTGTACCTTCCCTTCCCATCAGACCAAGCCGAGCACCGTCAA
GA
ACTCCTGGGCCTCCCAGTGCACAGAGTTCTCCTATTGACGCGCAGCCAGCAACGCCGCTGCCGCAGAA
A
GACCCCGCCCAGCCCTTGGAGCCCAAGCGGCCGCCGCCGCCCCGCCCGGTCGCCCCTCCCACACGCCCG
GCT
CCCCCACAGAGACCTCCTCCGCCTTCAGGGGCTAGGAGTCCTGCACCCACTAGAAAGGAATTTGGAG
CA
CCCAAAAGCCCTGGAACAACAAGGAAAGATAATATAGGACGCAGTCAGCCTTCACCTCAAGCAGGACT
T
GCAGGCCCAGGACCTGCTGGATACAGTACAGCCAGACCGACGATTCCTCCTCGTGCTGGAGTTATCAGT
GCC
CCACAGAGCCACGCGCGGGCATCTGCTGGAAGACTGACTCCTGAAAGCCAAAGCAAAACATCAGAAA
CG
TCGAAAGGTTCAACTTTCCTTCCTGAACCACTGAAGCCTCAGGCTGCTTTTCCTCCGCAGTCTTCTTT
G
CCCCCGCCTGCTCAAAGGTTGCAAGAGCCTCTTGTCCCTGTGGCAGCACCTATGCCTCAGTCTGGCCCC
CAG
CCAAATTTGGAAACCCCACCACAACCACCACCTCGAAGCAGGTCATCCCATAGCTTGCCTTCAGAAG
CT
TCCTCACAACCGCAACAGGAGCAACCATCAGGGTAA


Translation (1295 aa):
MAFSKGFRIYHKLDPPPFSLIVETRHKEECLMFESGAVAVLSSAEKEAIKGTYSKVLDAYGLLGVLRLNL
G
DTMLHYLVLVTGCMSVGKIQESEVFRVTSTEFISLRIDSSDEDRISEVRKVLNSGNFYFAWSASGISLD
L
SLNAHRSMQEQTTDNRFF
WNQSLHLHLKHYGVNCDDWLLRLMCGGVEIRTIYAAHKQAKACLISRLSCE
R
AGTRFNVRGTNDDGHVANFVETEQ
VVYLDDSVSSFIQIRGSVPLFWEQPGLQVGSHRVRMSRGFEANAP
A
FD
RHFRTLKNLYGKQIIVNLLGSKEGEHMLSKAFQSHLKASEHAADIQMVNFDYHQMVKGGKAEKLHSV
L
KPQVQKFLDYGFFYFNGSEVQ
RCQSGTVRTNCLDCLDRTNSVQAFLGLEMLAKQLEALGLAEKPQLVTR
F
QEVFRSMWSVNGDSISKIYAGTGALEGKAK
LKDGARSVTRTIQNNFFDSSKQEAIDVLLLGNTLNSDLA
D
KARALLTTGSLR
VSEQTLQSASSKVLKSMCENFYKYSKPKKIRVCVGTWNVNGGKQFRSIAFKNQTLTD
W
LLDAPKLAGIQEFQ
DKRSKPTDIFAIGFEEMVELNAGNIVSASTTNQKLWAVELQKTISRDNKYVLLAS
E
QLVGVCLFVFIRPQHAPFI
RDVAVDTVKTGMGGATGNKGAVAIRMLFHTTSLCFVCSHFAAGQSQVKER
N
EDFIEIARKLSFPM
GRMLFSHDYVFWCGDFNYRIDLPNEEVKELIRQQNWDSLIAGDQLINQKNAGQVF
R
GFLEGKVTFAPTYKYDLFSDDYDTSEKCRTPAWTDRVLWRRRKWPFDRS
AEDLDLLNASFQDESKILYT
W
TPGTLLHYGRAELKTSDH
RPVVALIDIDIFEVEAEERQNIYKEVIAVQGPPDGTVLVSIKSSLPENNFF
D
DALIDELLQQFASFGEVILI
RFVEDKMWVTFLEGSSALNVLSLNGKELLNRTITIALKSPDWIKNLEEE
M
SLEKISIALPSSTSSTLLGEDAEVAADFDME
GDVDDYSAEVEELLPQHLQPSSSSGLGTSPSSSPRTSP
C
QSPTISEGPVPSLPIRPSRAPSRTPGPPSAQ
SSPIDAQPATPLPQKDPAQPLEPKRPPPPRPVAPPTRP
A
PPQRPPPPS
GARSPAPTRKEFGAPKSPGTTRKDNIGRSQPSPQAGLAGPGPAGYSTARPTIPPRAGVIS
A
PQSHARASAGRLTPESQSKTSETSK
GSTFLPEPLKPQAAFPPQSSLPPPAQRLQEPLVPVAAPMPQSGP
Q
PNLETPPQPPPRSRSSHSLPSEASSQPQ
QEQPSG



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser