NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS54481.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
54481.1 Public Homo sapiens 21 KRTAP21-3 22 109 92 CCDS HistoryNCBI Gene:100288323Re-query CCDS DB by CCDS ID:54481.1Re-query CCDS DB by GeneID:100288323See the combined annotation on chromosome 21 in Sequence Viewer

Public since: CCDS release 8, NCBI annotation release 37.2, Ensembl annotation release 62

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 54481.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000444335.1 ENSP00000404517.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000444335.1Link to Ensembl Protein Viewer:ENSP00000404517.1Re-query CCDS DB by Nucleotide ID:ENST00000444335Re-query CCDS DB by Protein ID:ENSP00000404517
Original member Current member NCBI NM_001164435.1 NP_001157907.1 Accepted alive Link to Nucleotide Sequence:NM_001164435.1Link to Protein Sequence:NP_001157907.1Re-query CCDS DB by Nucleotide ID:NM_001164435Re-query CCDS DB by Protein ID:NP_001157907Link to BLAST:NP_001157907.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001157907.1 58 Q3LHN1 58 100% 0 0

Chromosomal Locations for CCDS 54481.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 21 (NC_000021.9)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21See the combined annotation on chromosome 21 in Sequence Viewer

Chromosome Start Stop Links
21 30718583 30718759 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (177 nt):
ATGTATTTCAATTACAAAAGTGTGTGTGGGAGCTGTGGATTTGGCTCTTGCTATGGTTGTGGGTATGGCT
GT
ATACACAGCACCCACTGTGGCTGTAACGGTTATTATGGTTGTTATGAAAATAAATATTCTGTTATAGA
T
GATCTGATATTTTTTGCTTCTAAGAAATGCCATTGA


Translation (58 aa):
MYFNYKSVCGSCGFGSCYGCGYGCIHSTHCGCNGYYGCYENKYSVIDDLIFFASKKCH



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser