NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS54467.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
54467.1 Under review, update Homo sapiens 20 CTSA 22 109 92 CCDS HistoryNCBI Gene:5476Re-query CCDS DB by CCDS ID:54467.1Re-query CCDS DB by GeneID:5476See the combined annotation on chromosome 20 in Sequence Viewer

Public since: CCDS release 8, NCBI annotation release 37.2, Ensembl annotation release 62

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 54467.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000354880.9 ENSP00000346952.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000354880.9Link to Ensembl Protein Viewer:ENSP00000346952.4Re-query CCDS DB by Nucleotide ID:ENST00000354880Re-query CCDS DB by Protein ID:ENSP00000346952
Original member NCBI NM_001167594.2 NP_001161066.1 Updated not alive Link to Nucleotide Sequence:NM_001167594.2Link to Protein Sequence:NP_001161066.1Re-query CCDS DB by Nucleotide ID:NM_001167594Re-query CCDS DB by Protein ID:NP_001161066
Current member NCBI NM_001167594.3 NP_001161066.2 Pending alive Link to Nucleotide Sequence:NM_001167594.3Link to Protein Sequence:NP_001161066.2Re-query CCDS DB by Nucleotide ID:NM_001167594Re-query CCDS DB by Protein ID:NP_001161066Link to BLAST:NP_001161066.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001161066.2 463 P10619-2 463 100% 0 0

Chromosomal Locations for CCDS 54467.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 20 (NC_000020.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20See the combined annotation on chromosome 20 in Sequence Viewer

Chromosome Start Stop Links
20 45891326 45891379 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 45891569 45891762 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 45891916 45892027 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 45892398 45892484 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 45892725 45892880 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 45893220 45893311 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 45893988 45894072 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 45894650 45894741 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 45894823 45894901 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 45894994 45895133 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 45896965 45897040 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 45897717 45897806 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 45898005 45898109 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 45898367 45898450 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1446 nt):
ATGACTTCCAGTCCCCGGGCGCCTCCTGGAGAGCAAGGACGCGGGGGAGCAGAGATGATCCGAGCCGCGC
CG
CCGCCGCTGTTCCTGCTGCTGCTGCTGCTGCTGCTGCTAGTGTCCTGGGCGTCCCGAGGCGAGGCAGC
C
CCCGACCAGGACGAGATCCAGCGCCTCCCCGGGCTGGCCAAGCAGCCGTCTTTCCGCCAGTACTCCGGC
TAC
CTCAAAGGCTCCGGCTCCAAGCACCTCCACTACTGGTTTGTGGAGTCCCAGAAGGATCCCGAGAACA
GC
CCTGTGGTGCTTTGGCTCAATGGGGGTCCCGGCTGCAGCTCACTAGATGGGCTCCTCACAGAGCATGG
C
CCCTTCCTGATTGCCAATGTGTTATACCTGGAGTCCCCAGCTGGGGTGGGCTTCTCCTACTCCGATGAC
AAG
TTTTATGCAACTAATGACACTGAGGTCGCCCAGAGCAATTTTGAGGCCCTTCAAGATTTCTTCCGCC
TC
TTTCCGGAGTACAAGAACAACAAACTTTTCCTGACCGGGGAGAGCTATGCTGGCATCTACATCCCCAC
C
CTGGCCGTGCTGGTCATGCAGGATCCCAGCATGAACCTTCAGGGGCTGGCTGTGGGCAATGGACTCTCC
TCC
TATGAGCAGAATGACAACTCCCTGGTCTACTTTGCCTACTACCATGGCCTTCTGGGGAACAGGCTTT
GG
TCTTCTCTCCAGACCCACTGCTGCTCTCAAAACAAGTGTAACTTCTATGACAACAAAGACCTGGAATG
C
GTGACCAATCTTCAGGAAGTGGCCCGCATCGTGGGCAACTCTGGCCTCAACATCTACAATCTCTATGCC
CCG
TGTGCTGGAGGGGTGCCCAGCCATTTTAGGTATGAGAAGGACACTGTTGTGGTCCAGGATTTGGGCA
AC
ATCTTCACTCGCCTGCCACTCAAGCGGATGTGGCATCAGGCACTGCTGCGCTCAGGGGATAAAGTGCG
C
ATGGACCCCCCCTGCACCAACACAACAGCTGCTTCCACCTACCTCAACAACCCGTACGTGCGGAAGGCC
CTC
AACATCCCGGAGCAGCTGCCACAATGGGACATGTGCAACTTTCTGGTAAACTTACAGTACCGCCGTC
TC
TACCGAAGCATGAACTCCCAGTATCTGAAGCTGCTTAGCTCACAGAAATACCAGATCCTATTATATAA
T
GGAGATGTAGACATGGCCTGCAATTTCATGGGGGATGAGTGGTTTGTGGATTCCCTCAACCAGAAGATG
GAG
GTGCAGCGCCGGCCCTGGTTAGTGAAGTACGGGGACAGCGGGGAGCAGATTGCCGGCTTCGTGAAGG
AG
TTCTCCCACATCGCCTTTCTCACGATCAAGGGCGCCGGCCACATGGTTCCCACCGACAAGCCCCTCGC
T
GCCTTCACCATGTTCTCCCGCTTCCTGAACAAGCAGCCATACTGA


Translation (481 aa):
MTSSPRAPPGEQGRGGAEMIRAAPPPLFLLLLLLLLLVSWASRGEAAPDQDEIQRLPGLAKQPSFRQYSG
Y
LKGSGSKHLHY
WFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLIANVLYLESPAGVGFSYSDD
K
FYATNDTE
VAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLS
S
YEQNDNSLVYFAYYHGLLGN
RLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYA
P
CAGGVPSHF
RYEKDTVVVQDLGNIFTRLPLKRMWHQALLRSGDKVRMDPPCTNTTAASTYLNNPYVRKA
L
NIPEQLPQWDMC
NFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKM
E
VQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIK
GAGHMVPTDKPLAAFTMFSRFLNKQPY



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser