NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS5439.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
5439.1 Public Homo sapiens 7 FKBP9 22 109 92 CCDS HistoryNCBI Gene:11328Re-query CCDS DB by CCDS ID:5439.1Re-query CCDS DB by GeneID:11328See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 5439.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000242209.8 ENSP00000242209.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000242209.8Link to Ensembl Protein Viewer:ENSP00000242209.4Re-query CCDS DB by Nucleotide ID:ENST00000242209Re-query CCDS DB by Protein ID:ENSP00000242209
Original member NCBI NM_007270.4 NP_009201.2 Updated not alive Link to Nucleotide Sequence:NM_007270.4Link to Protein Sequence:NP_009201.2Re-query CCDS DB by Nucleotide ID:NM_007270Re-query CCDS DB by Protein ID:NP_009201
Current member NCBI NM_007270.5 NP_009201.2 Accepted alive Link to Nucleotide Sequence:NM_007270.5Link to Protein Sequence:NP_009201.2Re-query CCDS DB by Nucleotide ID:NM_007270Re-query CCDS DB by Protein ID:NP_009201Link to BLAST:NP_009201.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_009201.2 570 O95302-1 570 100% 0 0

Chromosomal Locations for CCDS 5439.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 7 (NC_000007.14)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 32957574 32957794 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 32974617 32974762 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 32975182 32975371 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 32976354 32976499 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 32980364 32980553 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 32988507 32988652 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 32996163 32996349 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 33000115 33000260 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 33002676 33002839 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 33005175 33005351 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1713 nt):
ATGGCGTTCCGGGGCTGGAGGCCCCCGCCGCCACCGCTGCTCCTGCTGCTGCTCTGGGTGACCGGGCAGG
CA
GCGCCCGTGGCGGGCCTGGGCTCCGACGCGGAGCTGCAGATCGAGCGGCGCTTCGTGCCCGACGAGTG
C
CCGCGCACCGTGCGCAGCGGCGACTTCGTGCGCTACCACTACGTGGGGACGTTCCCCGACGGCCAGAAG
TTC
GACTCCAGCTATGACAGAGACTCCACTTTCAATGTGTTTGTGGGAAAAGGACAGCTGATCACAGGGA
TG
GACCAGGCTCTTGTTGGGATGTGCGTAAACGAGAGACGTTTCGTGAAGATTCCCCCAAAGCTTGCCTA
C
GGAAATGAAGGAGTTTCTGGTGTGATCCCCCCCAATTCAGTGCTTCATTTTGATGTACTTCTGATGGAT
ATT
TGGAATTCTGAAGACCAGGTTCAGATTCACACCTATTTCAAGCCCCCGAGTTGCCCTCGGACCATCC
AG
GTGTCTGATTTTGTGAGGTACCACTACAACGGGACGTTCCTGGACGGAACTCTGTTTGATTCGAGTCA
C
AATCGCATGAAAACATATGACACGTATGTGGGAATTGGCTGGCTGATTCCTGGAATGGATAAAGGGCTG
CTG
GGGATGTGTGTGGGTGAGAAGCGCATCATCACCATTCCTCCTTTTCTGGCCTATGGAGAGGATGGAG
AT
GGGAAAGACATTCCCGGTCAGGCATCTCTGGTGTTTGATGTTGCATTATTGGACCTCCATAACCCCAA
G
GACAGCATTTCCATTGAGAACAAGGTAGTACCTGAAAACTGTGAGCGGATAAGTCAAAGTGGGGACTTT
CTC
AGGTATCATTACAATGGCACGCTTCTGGATGGCACCCTCTTTGATTCCAGCTACTCTCGGAACCGCA
CG
TTTGACACGTACATTGGGCAGGGCTACGTGATTCCTGGGATGGATGAAGGTCTACTTGGTGTTTGCAT
T
GGAGAAAAGCGAAGGATTGTGGTCCCGCCTCACCTGGGGTATGGAGAGGAAGGAAGAGGGAATATCCCC
GGC
TCGGCTGTGCTGGTGTTTGACATCCATGTGATCGACTTCCACAACCCTTCGGACTCCATCAGCATCA
CC
TCCCACTACAAACCCCCTGACTGCTCAGTGCTGAGTAAGAAGGGAGATTACCTCAAATATCACTACAA
T
GCCTCACTTCTGGATGGGACCCTGCTGGACTCCACGTGGAATTTAGGCAAAACTTACAATATTGTTCTG
GGA
TCTGGGCAAGTTGTGTTGGGGATGGACATGGGTCTCAGAGAGATGTGCGTTGGCGAGAAACGGACAG
TG
ATCATTCCGCCTCACCTGGGCTATGGGGAAGCTGGCGTGGATGGAGAAGTGCCCGGCAGTGCCGTATT
A
GTGTTTGACATTGAGCTGCTGGAGCTGGTGGCTGGCCTTCCTGAGGGGTACATGTTCATATGGAATGGT
GAG
GTGTCACCCAACCTCTTTGAAGAAATTGACAAGGATGGCAACGGAGAAGTCCTCCTGGAAGAGTTCT
CA
GAGTACATTCACGCCCAGGTGGCATCTGGCAAAGGGAAACTCGCTCCTGGCTTTGATGCTGAGCTGAT
T
GTGAAGAATATGTTCACCAACCAGGACCGGAATGGAGATGGGAAGGTCACAGCCGAGGAATTTAAACTC
AAA
GACCAGGAAGCCAAACACGATGAACTCTAA


Translation (570 aa):
MAFRGWRPPPPPLLLLLLWVTGQAAPVAGLGSDAELQIERRFVPDECPRTVRSGDFVRYHYVGTFPDGQK
F
DS
SYDRDSTFNVFVGKGQLITGMDQALVGMCVNERRFVKIPPKLAYGNEGVSGVIPPNSVLHFDVLLMD
I
WNSEDQVQIHTYFKPPSCPRTIQVSDFVRYHYNGTFLDGTLFDS
SHNRMKTYDTYVGIGWLIPGMDKGL
L
GMCVGEKRIITIPPFLAYGEDGD
GKDIPGQASLVFDVALLDLHNPKDSISIENKVVPENCERISQSGDF
L
RYHYNGTLLDGTLFDS
SYSRNRTFDTYIGQGYVIPGMDEGLLGVCIGEKRRIVVPPHLGYGEEGRGNIP
G
SAVLVFDIHVIDFHNPSDSISITSHYKPPDCSVLSKKGDYLKYHYNASLLDGTLLDS
TWNLGKTYNIVL
G
SGQVVLGMDMGLREMCVGEKRTVIIPPHLGYGEAGV
DGEVPGSAVLVFDIELLELVAGLPEGYMFIWNG
E
VSPNLFEEIDKDGNGEVLLEE
FSEYIHAQVASGKGKLAPGFDAELIVKNMFTNQDRNGDGKVTAEEFKL
K
DQEAKHDEL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser