NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS54207.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
54207.1 Public Homo sapiens 19 PNPLA6 22 109 92 CCDS HistoryNCBI Gene:10908Re-query CCDS DB by CCDS ID:54207.1Re-query CCDS DB by GeneID:10908See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 8, NCBI annotation release 37.2, Ensembl annotation release 62

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 54207.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000545201.6 ENSP00000443323.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000545201.6Link to Ensembl Protein Viewer:ENSP00000443323.1Re-query CCDS DB by Nucleotide ID:ENST00000545201Re-query CCDS DB by Protein ID:ENSP00000443323
Original member Current member NCBI NM_001166112.1 NP_001159584.1 Accepted alive Link to Nucleotide Sequence:NM_001166112.1Link to Protein Sequence:NP_001159584.1Re-query CCDS DB by Nucleotide ID:NM_001166112Re-query CCDS DB by Protein ID:NP_001159584Link to BLAST:NP_001159584.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001159584.1 1300 Q8IY17-5 1300 100% 0 0

Chromosomal Locations for CCDS 54207.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 7535551 7535577 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7535933 7536020 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7536191 7536273 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7536449 7536546 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7539918 7540058 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7540149 7540308 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7540630 7540710 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7540923 7541051 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7541354 7541434 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7541522 7541684 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7541984 7542067 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7542561 7542670 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7542761 7542928 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7549907 7550112 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7550298 7550429 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7550517 7550640 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7550994 7551107 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7551362 7551437 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7553875 7554015 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7554209 7554272 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7554555 7554723 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7554893 7555075 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7555249 7555367 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7555607 7555763 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7556453 7556569 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7556655 7556724 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7557168 7557284 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7558850 7559151 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7560648 7560764 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7561014 7561110 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7561208 7561317 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 7561488 7561562 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3903 nt):
ATGGAGGCTCCGCTGCAAACTGGAATGGTGCTTGGCGTGATGATCGGGGCCGGAGTGGCGGTGGTGGTCA
CG
GCCGTGCTCATCCTCCTGGTGGTGCGGAGGCTGCGAGTGCCAAAAACCCCAGCCCCGGATGGCCCCCG
G
TATCGGTTCCGGAAGAGGGACAAAGTGCTCTTCTATGGCCGGAAGATTATGCGGAAGGTGTCACAATCC
ACC
TCCTCCCTCGTGGATACCTCTGTCTCCGCCACCTCCCGGCCACGCATGAGGAAGAAACTGAAGATGC
TC
AACATTGCCAAGAAGATCCTGCGCATCCAGAAAGAGACGCCCACGCTGCAGCGGAAGGAGCCCCCGCC
C
GCAGTGCTAGAAGCTGACCTGACCGAGGGCGACCTGGCTAACTCCCATCTGCCCTCTGAAGTGCTTTAT
ATG
CTCAAGAACGTCCGGGTGCTGGGCCACTTCGAGAAGCCACTCTTCCTGGAGCTCTGCCGCCACATGG
TC
TTCCAGCGGCTGGGCCAGGGTGACTACGTCTTCCGGCCGGGCCAGCCAGATGCCAGCATCTACGTGGT
G
CAGGACGGGCTGCTGGAGCTCTGTCTGCCAGGGCCTGACGGGAAGGAGTGTGTGGTGAAGGAAGTGGTT
CCT
GGGGACAGCGTCAACAGCCTTCTCAGCATCCTGGATGTCATCACCGGTCACCAGCATCCCCAGCGGA
CC
GTGTCTGCCCGGGCGGCCCGGGACTCCACGGTGCTGCGCCTGCCGGTGGAAGCATTCTCCGCGGTCTT
C
ACCAAGTACCCGGAGAGCTTGGTGCGGGTCGTGCAGATCATCATGGTGCGGCTGCAGCGAGTCACCTTC
CTG
GCACTGCACAACTACCTGGGTCTGACCAATGAGCTCTTCAGCCACGAGATCCAGCCCCTGCGTCTGT
TC
CCCAGCCCCGGCCTCCCAACTCGCACCAGCCCTGTGCGGGGCTCCAAGAGAATGGTCAGCACCTCAGC
T
ACAGACGAGCCCAGGGAGACCCCAGGGCGGCCACCCGATCCCACCGGGGCCCCGCTGCCTGGACCTACA
G
GG
GACCCTGTGAAGCCCACATCCCTGGAAACCCCCTCGGCCCCTCTGCTGAGCCGCTGCGTCTCCATGC
CA
GGGGACATCTCAGGCTTGCAGGGTGGCCCCCGCTCCGACTTCGACATGGCCTATGAGCGTGGCCGGAT
C
TCCGTGTCCCTGCAGGAAGAGGCCTCCGGGGGGTCCCTGGCAGCCCCCGCTCGGACCCCCACTCAGGAG
CCT
CGTGAGCAGCCGGCAGGCGCCTGTGAATACAGCTACTGTGAGGATGAGTCGGCCACTGGTGGCTGCC
CT
TTCGGGCCCTACCAGGGCCGCCAGACCAGCAGCATCTTCGAGGCAGCAAAGCAGGAGCTGGCCAAGCT
G
ATGCGGATTGAGGACGTGAGCCTGCACTTCGTGCTCTGGGGCTGCCTGCACGTGTACCAGCGCATGATC
GAC
AAGGCGGAGGACGTGTGCCTGTTCGTAGCGCAGCCCGGGGAACTGGTGGGGCAGCTGGCGGTGCTCA
CT
GGCGAACCTCTCATCTTCACACTGCGAGCCCAACGCGACTGCACCTTCCTGCGGATCTCCAAGTCCGA
C
TTCTATGAGATCATGCGCGCACAGCCCAGTGTGGTGCTGAGTGCGGCGCACACGGTGGCAGCCAGGATG
TCG
CCCTTCGTGCGCCAGATGGACTTCGCCATCGACTGGACTGCAGTGGAGGCGGGACGCGCGCTGTACA
G
G
CAGGGCGACCGCTCCGACTGCACTTACATCGTGCTCAATGGGCGGCTGCGTAGCGTGATCCAGCGAGG
C
AGTGGCAAGAAGGAGCTGGTGGGCGAGTACGGCCGCGGCGACCTCATCGGCGTGGTGGAGGCACTGACC
CGG
CAGCCGCGAGCCACGACGGTGCACGCGGTGCGCGACACGGAGCTGGCCAAGCTTCCCGAGGGCACCT
TG
GGTCACATCAAACGCCGGTACCCGCAGGTCGTGACCCGCCTTATCCACCTACTGAGCCAGAAAATTCT
A
GGGAATTTGCAGCAGCTGCAAGGACCCTTCCCAGGCTCTGGGTTGGGTGTGCCCCCACACTCGGAACTC
ACC
AACCCAGCCAGCAACCTGGCAACTGTGGCAATCCTGCCTGTGTGTGCTGAGGTCCCCATGGTGGCCT
TC
ACGCTGGAGCTGCAGCACGCCCTGCAGGCCATCGGTCCGACGCTACTCCTTAACAGTGACATCATCCG
G
GCACGCCTGGGGGCCTCCGCACTGGATAGCATCCAAGAGTTCCGGCTGTCAGGGTGGCTGGCCCAGCAG
GAG
GATGCACACCGTATCGTACTCTACCAGACGGACGCCTCGCTGACGCCCTGGACCGTGCGCTGCCTGC
GA
CAGGCCGACTGCATCCTCATTGTGGGCCTGGGGGACCAGGAGCCTACCCTCGGCCAGCTGGAGCAGAT
G
CTGGAGAACACGGCTGTGCGCGCCCTTAAGCAGCTAGTCCTGCTCCACCGAGAGGAGGGCGCGGGCCCC
ACG
CGCACCGTGGAGTGGCTAAATATGCGCAGCTGGTGCTCGGGGCACCTGCACCTGCGCTGTCCGCGCC
GC
CTCTTTTCGCGCCGCAGCCCTGCCAAGCTGCATGAGCTCTACGAGAAGGTTTTCTCCAGGCGCGCGGA
C
CGGCACAGCGACTTCTCCCGCTTGGCGAGGGTGCTCACGGGGAACACCATTGCCCTTGTGCTAGGCGGG
GGC
GGGGCCAGGGGCTGCTCGCACATCGGAGTACTAAAGGCATTAGAGGAGGCGGGGGTCCCCGTGGACC
TG
GTGGGCGGCACGTCCATTGGCTCTTTCATCGGAGCGTTGTACGCGGAGGAGCGCAGCGCCAGCCGCAC
G
AAGCAGCGGGCCCGGGAGTGGGCCAAGAGCATGACTTCGGTGCTGGAACCTGTGTTGGACCTCACGTAC
CCA
GTCACCTCCATGTTCACTGGGTCTGCCTTTAACCGCAGCATCCATCGGGTCTTCCAGGATAAGCAGA
TT
GAGGACCTGTGGCTGCCTTACTTCAACGTGACCACAGATATCACCGCCTCAGCCATGCGAGTCCACAA
A
GATGGCTCCCTGTGGCGGTACGTGCGCGCCAGCATGACGCTGTCGGGCTACCTGCCCCCGCTGTGCGAC
CCC
AAGGACGGGCACCTACTCATGGATGGCGGCTACATCAACAATCTGCCAGCGGACATCGCCCGCAGCA
TG
GGTGCCAAAACGGTCATCGCCATTGACGTGGGGAGCCAGGATGAGACGGACCTCAGCACCTACGGGGA
C
AGCCTGTCCGGCTGGTGGCTGCTGTGGAAGCGGCTGAATCCCTGGGCTGACAAGGTAAAGGTTCCAGAC
ATG
GCTGAAATCCAGTCCCGCCTGGCCTACGTGTCCTGTGTGCGGCAGCTAGAGGTTGTCAAGTCCAGCT
CC
TACTGCGAGTACCTGCGCCCGCCCATCGACTGCTTCAAGACCATGGACTTTGGGAAGTTCGACCAGAT
C
TATGATGTGGGCTACCAGTACGGGAAGGCGGTGTTTGGAGGCTGGAGCCGTGGCAACGTCATTGAGAAA
ATG
CTCACAGACCGGCGGTCTACAGACCTTAATGAGAGCCGCCGTGCAGACGTGCTTGCCTTCCCAAGCT
CT
GGCTTCACTGACTTGGCAGAGATTGTGTCCCGGATTGAGCCCCCCACGAGCTATGTCTCTGATGGCTG
T
GCTGACGGAGAGGAGTCAGATTGTCTGACAGAGTATGAGGAGGACGCCGGACCCGACTGCTCGAGGGAT
GAA
GGGGGGTCCCCCGAGGGCGCAAGCCCCAGCACTGCCTCCGAGATGGAGGAGGAGAAGTCGATTCTCC
GG
CAACGACGCTGTCTGCCCCAGGAGCCGCCCGGCTCAGCCACAGATGCCTGA


Translation (1300 aa):
MEAPLQTGMVLGVMIGAGVAVVVTAVLILLVVRRLRVPKTPAPDGPRYRFRKRDKVLFYGRKIMRKVSQS
T
SSLVDTSVSATSRPRMRKKLKMLNIAK
KILRIQKETPTLQRKEPPPAVLEADLTEGDLANSHLPSEVLY
M
LKNV
RVLGHFEKPLFLELCRHMVFQRLGQGDYVFRPGQPDASIYVVQDGLLELCLPGPDGKECVVKEVV
P
GDSVNSLLSILDVIT
GHQHPQRTVSARAARDSTVLRLPVEAFSAVFTKYPESLVRVVQIIMVRLQRVTF
L
ALHNYLGLTNELFSH
EIQPLRLFPSPGLPTRTSPVRGSKRMVSTSATDEPRETPGRPPDPTGAPLPGPT
G
DPVKPTSLETPSAPLLSRCVSMPGDISGLQGGPRSDFDMAYERGRISVSLQEEASGGSLAAPARTPTQE
P
REQPAGACEYSYCEDESATGGCPFGPYQGRQTSSIFEAAKQELAKLMRIE
DVSLHFVLWGCLHVYQRMI
D
KAEDVCLFVAQPGELVGQLAVLTGEPLIFTLRAQRDCTFLRISKSDFY
EIMRAQPSVVLSAAHTVAARM
S
PFVRQMDFAIDWTAVEAGRALY
RQGDRSDCTYIVLNGRLRSVIQRGSGKKELVGEYGRGDLIGVVEALT
R
QPRATTVHAVRDTELAKLPEGTLGHIKRRYPQ
VVTRLIHLLSQKILGNLQQLQGPFPGSGLGVPPHSEL
T
NPASNLATVAILPVCAEVPMVAFTLELQHALQAI
GPTLLLNSDIIRARLGASALDSIQEFRLSGWLAQQ
E
DAHRIVLYQTDASLTPWTVRCLRQADCILIVGLGDQEPTLGQ
LEQMLENTAVRALKQLVLLHREEGAGP
T
RTVEWLNMRSWCSGHLHLRCPRRLFSRRSPAKL
HELYEKVFSRRADRHSDFSRLARVLTGNTIALVLGG
G
GA
RGCSHIGVLKALEEAGVPVDLVGGTSIGSFIGALYAEERSASRTKQRAREWAKSMTSVLEPVLDLTY
P
VTSMFTGSAFNRSIHRVFQDKQIE
DLWLPYFNVTTDITASAMRVHKDGSLWRYVRASMTLSGYLPPLCD
P
KDGHLLMDGGYINNLP
ADIARSMGAKTVIAIDVGSQDETDLSTYGDSLSGWWLLWKRLNPWADKVKVPD
M
AEIQSRLAYVSCVRQLEVVKSSSYCEYLRPPIDCFKTMDFGKFDQIY
DVGYQYGKAVFGGWSRGNVIEK
M
LTDRRSTDLNESRRAD
VLAFPSSGFTDLAEIVSRIEPPTSYVSDGCADGEESDCLTEYEEDAGPDCSRD
E
GGSPEGASPSTASEM
EEEKSILRQRRCLPQEPPGSATDA



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser