NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS54058.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
54058.1 Public Homo sapiens 16 PIEZO1 22 109 92 CCDS HistoryNCBI Gene:9780Re-query CCDS DB by CCDS ID:54058.1Re-query CCDS DB by GeneID:9780See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 8, NCBI annotation release 37.2, Ensembl annotation release 62

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 54058.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000301015.14 ENSP00000301015.9 Accepted alive Link to Ensembl Transcript Viewer:ENST00000301015.14Link to Ensembl Protein Viewer:ENSP00000301015.9Re-query CCDS DB by Nucleotide ID:ENST00000301015Re-query CCDS DB by Protein ID:ENSP00000301015
Original member NCBI NM_001142864.3 NP_001136336.2 Updated not alive Link to Nucleotide Sequence:NM_001142864.3Link to Protein Sequence:NP_001136336.2Re-query CCDS DB by Nucleotide ID:NM_001142864Re-query CCDS DB by Protein ID:NP_001136336
Current member NCBI NM_001142864.4 NP_001136336.2 Accepted alive Link to Nucleotide Sequence:NM_001142864.4Link to Protein Sequence:NP_001136336.2Re-query CCDS DB by Nucleotide ID:NM_001142864Re-query CCDS DB by Protein ID:NP_001136336Link to BLAST:NP_001136336.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001136336.2 2521 Q92508 2521 100% 0 0

Chromosomal Locations for CCDS 54058.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 88715605 88715854 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88715933 88716119 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88716198 88716277 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88716361 88716483 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88716559 88716731 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88716806 88716898 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88717023 88717211 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88719574 88719721 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88719802 88719960 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88720069 88720283 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88720385 88720532 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88720616 88720748 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88721166 88721430 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88721538 88721726 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88721808 88722066 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88722218 88722397 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88722583 88722689 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88722837 88723009 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88723095 88723151 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88723226 88723328 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88723871 88723971 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88725009 88725080 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88725416 88725519 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88725595 88725684 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88726284 88726455 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88726547 88726643 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88726715 88726958 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88727039 88727192 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88727557 88727661 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88731706 88731910 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88732335 88732535 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88732607 88732732 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88733278 88733454 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88733588 88733745 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88733906 88734054 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88734356 88734538 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88734650 88734798 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88734875 88735053 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88735135 88735246 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88736148 88736408 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88736639 88736739 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88737559 88737646 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88737728 88737814 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88737934 88738105 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88738227 88738440 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88738568 88738736 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88741478 88741616 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88742053 88742095 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88742300 88742422 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88749384 88749479 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88784901 88784964 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (7566 nt):
ATGGAGCCGCACGTGCTCGGCGCGGTCCTGTACTGGCTGCTGCTGCCCTGCGCGCTGCTGGCTGCCTGCC
TG
CTCCGCTTCAGCGGACTCTCGCTGGTCTACCTGCTCTTCCTGCTGCTGCTGCCCTGGTTCCCCGGCCC
C
ACCCGATGCGGCCTCCAAGGTCACACAGGCCGCCTCCTGCGGGCATTGCTGGGCCTCAGCCTGCTCTTC
CTG
GTGGCCCATCTCGCCCTCCAGATCTGCCTGCATATTGTGCCCCGCCTGGACCAGCTCCTGGGACCCA
GC
TGCAGCCGCTGGGAGACCCTCTCGCGACACATAGGGGTCACAAGGCTGGACCTGAAGGACATCCCCAA
C
GCCATCCGGCTGGTGGCCCCTGACCTGGGCATCTTGGTGGTCTCCTCTGTCTGCCTCGGCATCTGCGGG
CGC
CTTGCAAGGAACACCCGGCAGAGCCCACATCCACGGGAGCTGGATGATGATGAGAGGGATGTGGATG
CC
AGCCCGACGGCAGGGCTGCAGGAAGCAGCAACGCTGGCCCCTACACGGAGGTCACGGCTGGCCGCTCG
T
TTCCGAGTCACGGCCCACTGGCTGCTGGTGGCGGCTGGGCGGGTCCTGGCCGTAACACTGCTTGCACTG
GCA
GGCATCGCCCACCCCTCGGCCCTCTCCAGTGTCTACCTGCTGCTCTTCCTGGCCCTCTGCACCTGGT
GG
GCCTGCCACTTTCCCATCAGCACTCGGGGCTTCAGCAGACTCTGCGTCGCGGTGGGGTGCTTCGGCGC
C
GGCCATCTCATCTGCCTCTACTGCTACCAGATGCCCTTGGCACAGGCTCTGCTCCCGCCTGCCGGCATC
TGG
GCTAGGGTGCTGGGTCTCAAGGACTTCGTGGGTCCCACCAACTGCTCCAGCCCCCACGCGCTGGTCC
TC
AACACCGGCCTGGACTGGCCTGTGTATGCCAGCCCCGGCGTCCTCCTGCTGCTGTGCTACGCCACGGC
C
TCTCTGCGCAAGCTCCGCGCGTACCGCCCCTCCGGCCAGAGGAAGGAGGCGGCAAAGGGGTATGAGGCT
CGG
GAGCTGGAGCTAGCAGAGCTGGACCAGTGGCCCCAGGAACGGGAGTCTGACCAGCACGTGGTGCCCA
CA
GCACCCGACACCGAGGCTGATAACTGCATCGTGCACGAGCTGACCGGCCAGAGCTCCGTCCTGCGGCG
G
CCTGTGCGGCCCAAGCGGGCTGAGCCCAGGGAGGCGTCTCCGCTCCACAGCCTGGGCCACCTCATCATG
GAC
CAGAGCTATGTGTGCGCGCTCATTGCCATGATGGTATGGAGCATCACCTACCACAGCTGGCTGACCT
TC
GTACTGCTGCTCTGGGCCTGCCTCATCTGGACGGTGCGCAGCCGCCACCAACTGGCCATGCTGTGCTC
G
CCCTGCATCCTGCTGTATGGGATGACGCTGTGCTGCCTACGCTACGTGTGGGCCATGGACCTGCGCCCT
GAG
CTGCCCACCACCCTGGGCCCCGTCAGCCTGCGCCAGCTGGGGCTGGAGCACACCCGCTACCCCTGTC
TG
GACCTTGGTGCCATGTTGCTCTACACCCTGACCTTCTGGCTCCTGCTGCGCCAGTTTGTGAAAGAGAA
G
CTGCTGAAGTGGGCAGAGTCTCCAGCTGCGCTGACGGAGGTCACCGTGGCAGACACAGAGCCCACGCGG
ACG
CAGACGCTGTTGCAGAGCCTGGGGGAGCTGGTGAAGGGCGTGTACGCCAAGTACTGGATCTATGTGT
GT
GCTGGCATGTTCATCGTGGTCAGCTTCGCCGGCCGCCTCGTGGTCTACAAGATTGTCTACATGTTCCT
C
TTCCTGCTCTGCCTCACCCTCTTCCAGGTCTACTACAGCCTGTGGCGGAAGCTGCTCAAGGCCTTCTGG
TGG
CTCGTGGTGGCCTACACCATGCTGGTCCTCATCGCCGTCTACACCTTCCAGTTCCAGGACTTCCCTG
CC
TACTGGCGCAACCTCACTGGCTTCACCGACGAGCAGCTGGGGGACCTGGGCCTGGAGCAGTTCAGCGT
G
TCCGAGCTCTTCTCCAGCATCCTGGTGCCCGGCTTCTTCCTCCTGGCCTGCATCCTGCAGCTGCACTAC
TTC
CACAGGCCCTTCATGCAGCTCACCGACATGGAGCACGTGTCCCTGCCTGGCACGCGCCTCCCGCGCT
GG
GCTCACAGGCAGGATGCAGTGAGTGGGACCCCACTGCTGCGGGAGGAGCAGCAGGAGCATCAGCAGCA
G
CAGCAGGAGGAGGAGGAGGAGGAGGAGGACTCCAGGGACGAGGGGCTGGGCGTGGCCACTCCCCACCAG
GCC
ACGCAGGTGCCTGAAGGGGCAGCCAAGTGGGGCCTGGTGGCTGAGCGGCTGCTGGAGCTGGCAGCCG
GC
TTCTCGGACGTCCTCTCACGCGTGCAGGTGTTCCTGCGGCGGCTGCTGGAGCTTCACGTTTTCAAGCT
G
GTGGCCCTGTACACCGTCTGGGTGGCCCTGAAGGAGGTGTCGGTGATGAACCTGCTGCTGGTGGTGCTG
TGG
GCCTTCGCCCTGCCCTACCCACGCTTCCGGCCCATGGCCTCCTGCCTGTCCACCGTGTGGACCTGCG
TC
ATCATCGTGTGTAAGATGCTGTACCAGCTCAAGGTTGTCAACCCCCAGGAGTATTCCAGCAACTGCAC
C
GAGCCCTTCCCCAACAGCACCAACTTGCTGCCCACGGAGATCAGCCAGTCCCTGCTGTACCGGGGGCCC
GTG
GACCCTGCCAACTGGTTTGGGGTGCGGAAAGGGTTCCCCAACCTGGGCTACATCCAGAACCACCTGC
AA
GTGCTGCTGCTGCTGGTATTCGAGGCCATCGTGTACCGGCGCCAGGAGCACTACCGCCGGCAGCACCA
G
CTGGCCCCGCTGCCTGCCCAGGCCGTGTTTGCCAGCGGCACCCGCCAGCAGCTGGACCAGGATCTGCTC
GGC
TGCCTCAAGTACTTCATCAACTTCTTCTTCTACAAATTCGGGCTGGAGATCTGCTTCCTGATGGCCG
TG
AACGTGATCGGGCAGCGCATGAACTTTCTGGTGACCCTGCACGGTTGCTGGCTGGTGGCCATCCTCAC
C
CGCAGGCACCGCCAGGCCATTGCCCGCCTCTGGCCCAACTACTGCCTCTTCCTGGCGCTGTTCCTGCTG
TAC
CAGTACCTGCTGTGCCTGGGGATGCCCCCGGCCCTGTGCATTGATTATCCCTGGCGCTGGAGCCGGG
CC
GTCCCCATGAACTCCGCACTCATCAAGTGGCTGTACCTGCCTGATTTCTTCCGGGCCCCCAACTCCAC
C
AACCTCATCAGCGACTTTCTCCTGCTGCTGTGCGCCTCCCAGCAGTGGCAGGTGTTCTCAGCTGAGCGC
ACA
GAGGAGTGGCAGCGCATGGCTGGCGTCAACACCGACCGCCTGGAGCCGCTGCGGGGGGAGCCCAACC
CC
GTGCCCAACTTTATCCACTGCAGGTCCTACCTTGACATGCTGAAGGTGGCCGTCTTCCGATACCTGTT
C
TGGCTGGTGCTGGTGGTGGTGTTTGTCACGGGGGCCACCCGCATCAGCATCTTCGGGCTGGGCTACCTG
CTG
GCCTGCTTCTACCTGCTGCTCTTCGGCACGGCCCTGCTGCAGAGGGACACACGGGCCCGCCTCGTGC
TG
TGGGACTGCCTCATTCTGTACAACGTCACCGTCATCATCTCCAAGAACATGCTGTCGCTCCTGGCCTG
C
GTCTTCGTGGAGCAGATGCAGACCGGCTTCTGCTGGGTCATCCAGCTCTTCAGCCTTGTATGCACCGTC
AAG
GGCTACTATGACCCCAAGGAGATGATGGACAGAGACCAGGACTGCCTGCTGCCTGTGGAGGAGGCTG
GC
ATCATCTGGGACAGCGTCTGCTTCTTCTTCCTGCTGCTGCAGCGCCGCGTCTTCCTTAGCCATTACTA
C
CTGCACGTCAGGGCCGACCTCCAGGCCACCGCCCTGCTAGCCTCCAGGGGCTTCGCCCTCTACAACGCT
GCC
AACCTCAAGAGCATTGACTTTCACCGCAGGATAGAGGAGAAGTCCCTGGCCCAGCTGAAAAGACAGA
TG
GAGCGTATCCGTGCCAAGCAGGAGAAGCACAGGCAGGGCCGGGTGGACCGCAGTCGCCCCCAGGACAC
C
CTGGGCCCCAAGGACCCCGGCCTGGAGCCAGGGCCCGACAGTCCAGGGGGCTCCTCCCCGCCACGGAGG
CAG
TGGTGGCGGCCCTGGCTGGACCACGCCACAGTCATCCACTCCGGGGACTACTTCCTGTTTGAGTCCG
AC
AGTGAGGAAGAGGAGGAGGCTGTTCCTGAAGACCCGAGGCCGTCGGCACAGAGTGCCTTCCAGCTGGC
G
TACCAGGCATGGGTGACCAACGCCCAGGCGGTGCTGAGGCGGCGGCAGCAGGAGCAGGAGCAGGCAAGG
CAG
GAACAGGCAGGACAGCTACCCACAGGAGGTGGTCCCAGCCAGGAGGTGGAGCCAGCAGAGGGCCCCG
AG
GAGGCAGCGGCAGGCCGGAGCCATGTGGTGCAGAGGGTGCTGAGCACGGCGCAGTTCCTGTGGATGCT
G
GGGCAGGCGCTAGTGGATGAGCTGACACGCTGGCTGCAGGAGTTCACCCGGCACCACGGCACCATGAGC
GAC
GTGCTGCGGGCAGAGCGCTACCTCCTCACACAGGAGCTCCTGCAGGGCGGCGAAGTGCACAGGGGCG
TG
CTGGATCAGCTGTACACAAGCCAGGCCGAGGCCACGCTGCCAGGCCCCACCGAGGCCCCCAATGCCCC
A
AGCACCGTGTCCAGTGGGCTGGGCGCGGAGGAGCCACTCAGCAGCATGACAGACGACATGGGCAGCCCC
CTG
AGCACCGGCTACCACACGCGCAGTGGCAGTGAGGAGGCAGTCACCGACCCCGGGGAGCGTGAGGCTG
GT
GCCTCTCTGTACCAGGGACTGATGCGGACGGCCAGCGAGCTGCTCCTGGACAGGCGCCTGCGCATCCC
A
GAGCTGGAGGAGGCAGAGCTGTTTGCGGAGGGGCAGGGCCGGGCGCTGCGGCTGCTGCGGGCCGTGTAC
CAG
TGTGTGGCCGCCCACTCGGAGCTGCTCTGCTACTTCATCATCATCCTCAACCACATGGTCACGGCCT
CC
GCCGGCTCGCTGGTGCTGCCCGTGCTCGTCTTCCTGTGGGCCATGCTGTCGATCCCGAGGCCCAGCAA
G
CGCTTCTGGATGACGGCCATCGTCTTCACCGAGATCGCGGTGGTCGTCAAGTACCTGTTCCAGTTTGGG
TTC
TTCCCCTGGAACAGCCACGTGGTGCTGCGGCGCTACGAGAACAAGCCCTACTTCCCGCCCCGCATCC
TG
GGCCTGGAGAAGACTGACGGCTACATCAAGTACGACCTGGTGCAGCTCATGGCCCTTTTCTTCCACCG
C
TCCCAGCTGCTGTGCTATGGCCTCTGGGACCATGAGGAGGACTCACCATCCAAGGAGCATGACAAGAGC
GGC
GAGGAGGAGCAGGGAGCCGAGGAGGGGCCAGGGGTGCCTGCGGCCACCACCGAAGACCACATTCAGG
TG
GAAGCCAGGGTCGGACCCACGGACGGGACCCCAGAACCCCAAGTGGAGCTCAGGCCCCGTGATACGAG
G
CGCATCAGTCTACGTTTTAGAAGAAGGAAGAAGGAGGGCCCAGCACGGAAAGGAGCGGCAGCCATCGAA
GCT
GAGGACAGGGAGGAAGAAGAGGGGGAGGAAGAGAAAGAGGCCCCCACGGGGAGAGAGAAGAGGCCAA
GC
CGCTCTGGAGGAAGAGTAAGGGCGGCCGGGCGGCGGCTGCAGGGCTTCTGCCTGTCCCTGGCCCAGGG
C
ACATATCGGCCGCTACGGCGCTTCTTCCACGACATCCTGCACACCAAGTACCGCGCAGCCACCGACGTC
TAT
GCCCTCATGTTCCTGGCTGATGTTGTCGACTTCATCATCATCATTTTTGGCTTCTGGGCCTTTGGGA
AG
CACTCGGCGGCCACAGACATCACGTCCTCCCTATCAGACGACCAGGTACCCGAGGCTTTCCTGGTCAT
G
CTGCTGATCCAGTTCAGTACCATGGTGGTTGACCGCGCCCTCTACCTGCGCAAGACCGTGCTGGGCAAG
CTG
GCCTTCCAGGTGGCGCTGGTGCTGGCCATCCACCTATGGATGTTCTTCATCCTGCCCGCCGTCACTG
AG
AGGATGTTCAACCAGAATGTGGTGGCCCAGCTCTGGTACTTCGTGAAGTGCATCTACTTCGCCCTGTC
C
GCCTACCAGATCCGCTGCGGCTACCCCACCCGCATCCTCGGCAACTTCCTCACCAAGAAGTACAATCAT
CTC
AACCTCTTCCTCTTCCAGGGGTTCCGGCTGGTGCCGTTCCTGGTGGAGCTGCGGGCAGTGATGGACT
GG
GTGTGGACGGACACCACGCTGTCCCTGTCCAGCTGGATGTGTGTGGAGGACATCTATGCCAACATCTT
C
ATCATCAAATGCAGCCGAGAGACAGAGAAGAAATACCCGCAGCCCAAAGGGCAGAAGAAGAAGAAGATC
GTC
AAGTACGGCATGGGTGGCCTCATCATCCTCTTCCTCATCGCCATCATCTGGTTCCCACTGCTCTTCA
TG
TCGCTGGTGCGCTCCGTGGTTGGGGTTGTCAACCAGCCCATCGATGTCACCGTCACCCTGAAGCTGGG
C
GGCTATGAGCCGCTGTTCACCATGAGCGCCCAGCAGCCGTCCATCATCCCCTTCACGGCCCAGGCCTAT
GAG
GAGCTGTCCCGGCAGTTTGACCCCCAGCCGCTGGCCATGCAGTTCATCAGCCAGTACAGCCCTGAGG
AC
ATCGTCACGGCGCAGATTGAGGGCAGCTCCGGGGCGCTGTGGCGCATCAGTCCCCCCAGCCGTGCCCA
G
ATGAAGCGGGAGCTCTACAACGGCACGGCCGACATCACCCTGCGCTTCACCTGGAACTTCCAGAGGGAC
CTG
GCGAAGGGAGGCACTGTGGAGTATGCCAACGAGAAGCACATGCTGGCCCTGGCCCCCAACAGCACTG
CA
CGGCGGCAGCTGGCCAGCCTGCTCGAGGGCACCTCGGACCAGTCTGTGGTCATCCCTAATCTCTTCCC
C
AAGTACATCCGTGCCCCCAACGGGCCCGAAGCCAACCCTGTGAAGCAGCTGCAGCCCAATGAGGAGGCC
GAC
TACCTCGGCGTGCGTATCCAGCTGCGGAGGGAGCAGGGTGCGGGGGCCACCGGCTTCCTCGAATGGT
GG
GTCATCGAGCTGCAGGAGTGCCGGACCGACTGCAACCTGCTGCCCATGGTCATTTTCAGTGACAAGGT
C
AGCCCACCGAGCCTCGGCTTCCTGGCTGGCTACGGCATCATGGGGCTGTACGTGTCCATCGTGCTGGTC
ATC
GGCAAGTTCGTGCGCGGATTCTTCAGCGAGATCTCGCACTCCATTATGTTCGAGGAGCTGCCGTGCG
TG
GACCGCATCCTCAAGCTCTGCCAGGACATCTTCCTGGTGCGGGAGACTCGGGAGCTGGAGCTGGAGGA
G
GAGTTGTACGCCAAGCTCATCTTCCTCTACCGCTCACCGGAGACCATGATCAAGTGGACTCGTGAGAAG
GAG
TAG


Translation (2521 aa):
MEPHVLGAVLYWLLLPCALLAACLLRFSGLSLVYLLFLLLLPWFPGPTRCGLQGHTGRLLRALLGLSLLF
L
VAHLALQICLHIVPRLDQLLGPS
CSRWETLSRHIGVTRLDLKDIPNAIRLVAPDLGILVVSSVCLGICG
R
LARNTRQSPHPREL
DDDERDVDASPTAGLQEAATLAPTRRSRLAARFRVTAHWLLVAAGRVLAVTLLAL
A
GIAHPSALSSVYLLLFLALCTWWACHFPISTRGFSRLCVAVGCFGAGHLICLYCYQMPLAQALLPPAGI
W
A
RVLGLKDFVGPTNCSSPHALVLNTGLDWPVYASPGVLLLLCYATASLRKLRAYRPSGQRKEAAKGYEA
R
ELELAELDQWPQERESDQ
HVVPTAPDTEADNCIVHELTGQSSVLRRPVRPKRAEPREASPLHSLGHLIM
D
QSYVCALIAMM
VWSITYHSWLTFVLLLWACLIWTVRSRHQLAMLCSPCILLYGMTLCCLRYVWAMDLRP
E
LPTTLGPVSLRQLGLEHTRYPCLDLGAM
LLYTLTFWLLLRQFVKEKLLKWAESPAALTEVTVADTEPTR
T
QTLLQSLGELVKGVYAKYWIYVCAGMFIVVSFAGRLVVYKIVYMFLFLLCLTLFQ
VYYSLWRKLLKAFW
W
LVVAYTMLVLIAVYTFQFQDFPAYWRNLTGFTDE
QLGDLGLEQFSVSELFSSILVPGFFLLACILQLHY
F
HRPFMQLTDMEHVSLPGTRLPRWAH
RQDAVSGTPLLREEQQEHQQQQQEEEEEEEDSRDEGLGVATPHQ
A
TQVPE
GAAKWGLVAERLLELAAGFSDVLSRVQVFLRRLLELHVFKLVALYTVWVALKEVSVMNLLLVVL
W
AFALPYPRFRPMASCLSTVWTCVIIVCKMLYQLKVVNPQEYSSNCTE
PFPNSTNLLPTEISQSLLYRGP
V
DPANWFGVRKGFPNLGYIQ
NHLQVLLLLVFEAIVYRRQEHYRRQHQLAPLPAQAVFASGTRQQLDQDLL
G
CLKYFINFFFYKFGLE
ICFLMAVNVIGQRMNFLVTLHGCWLVAILTRRHRQAIARLWPNYCLFLALFLL
Y
QYLLCLGMPPALCI
DYPWRWSRAVPMNSALIKWLYLPDFFRAPNSTNLISDFLLLLCASQQWQVFSAER
T
EEWQRMAGVNTDRLEPLRGEPNPVPNFIHC
RSYLDMLKVAVFRYLFWLVLVVVFVTGATRISIFGLGYL
L
ACFYLLLFGTALLQRDTRARLVLWDCLILYNVTVIISKNMLS
LLACVFVEQMQTGFCWVIQLFSLVCTV
K
GYYD
PKEMMDRDQDCLLPVEEAGIIWDSVCFFFLLLQRRVFLSHYYLHVRADLQATALLASRGFALYNA
A
NLKSIDFHRRIEEKSLAQLKR
QMERIRAKQEKHRQGRVDRSRPQDTLGPKDPGLEPGPDSPGGSSPPRR
Q
WWRPWLDHAT
VIHSGDYFLFESDSEEEEEAVPEDPRPSAQSAFQLAYQAWVTNAQAVLRRRQQEQEQAR
Q
EQAGQLPT
GGGPSQEVEPAEGPEEAAAGRSHVVQRVLSTAQFLWMLGQALVDELTRWLQEFTRHHGTMS
D
VLRAERYLLTQELLQ
GGEVHRGVLDQLYTSQAEATLPGPTEAPNAPSTVSSGLGAEEPLSSMTDDMGSP
L
STGYHTRSGSEEAVTDPGEREAGASLYQGLMRTASELLLD
RRLRIPELEEAELFAEGQGRALRLLRAVY
Q
CVAAHSELLCYFIIILNHMVTASAGSLVLPVLVFLWAMLSIPRPSKRFWMTAIVFTE
IAVVVKYLFQFG
F
FPWNSHVVLRRYENKPYFPPRILGLEKTDGYIKYDLVQLMALFFHRSQLL
CYGLWDHEEDSPSKEHDKS
G
EEEQGAEEGPGVPAATTEDHIQVEARVGPTDGTPEPQVELRPRDTRRISLRFRRRKKEGPARKGAAAI
E
A
EDREEEEGEEEKEAPTGREKRPSRSGGRVRAAGRRLQGFCLS
LAQGTYRPLRRFFHDILHTKYRAATDV
Y
ALMFLADVVDFIIIIFGFWAFG
KHSAATDITSSLSDDQVPEAFLVMLLIQFSTMVVDRALYLRKTVLGK
L
AFQVALVLAIHLWMFFILPAVTE
RMFNQNVVAQLWYFVKCIYFALSAYQIRCGYPTRILGNFLTKKYNH
L
NLFLFQ
GFRLVPFLVELRAVMDWVWTDTTLSLSSWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKKI
V
KYGMGGLIILFLIAIIWFPLLFMSLVRSVVGVVNQPIDVTVTLKLGGYE
PLFTMSAQQPSIIPFTAQAY
E
ELSRQFDPQP
LAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTADITLRFTWNFQRD
L
AKGGTVEYANEKHMLALAPNSTARRQLASLLEGTSDQS
VVIPNLFPKYIRAPNGPEANPVKQLQPNEEA
D
YLGVRIQLRREQGAGATGFLEWWVIELQECRTDCNLLPMVIFSDKVSPPSLGFLAGY
GIMGLYVSIVLV
I
GKFVRGFFSEISHSIMFEELPCVDRILKLCQDIFLVRETRELELEEELYAKLIFLYRSPETMIKWTREK
E




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser