NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS53940.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
53940.1 Public Homo sapiens 15 SLC12A1 22 109 92 CCDS HistoryNCBI Gene:6557Re-query CCDS DB by CCDS ID:53940.1Re-query CCDS DB by GeneID:6557See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 8, NCBI annotation release 37.2, Ensembl annotation release 62

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 53940.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000396577.7 ENSP00000379822.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000396577.7Link to Ensembl Protein Viewer:ENSP00000379822.3Re-query CCDS DB by Nucleotide ID:ENST00000396577Re-query CCDS DB by Protein ID:ENSP00000379822
Original member Current member EBI ENST00000647232.1 ENSP00000493875.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000647232.1Link to Ensembl Protein Viewer:ENSP00000493875.1Re-query CCDS DB by Nucleotide ID:ENST00000647232Re-query CCDS DB by Protein ID:ENSP00000493875
Original member NCBI NM_001184832.1 NP_001171761.1 Updated not alive Link to Nucleotide Sequence:NM_001184832.1Link to Protein Sequence:NP_001171761.1Re-query CCDS DB by Nucleotide ID:NM_001184832Re-query CCDS DB by Protein ID:NP_001171761
Current member NCBI NM_001184832.2 NP_001171761.1 Accepted alive Link to Nucleotide Sequence:NM_001184832.2Link to Protein Sequence:NP_001171761.1Re-query CCDS DB by Nucleotide ID:NM_001184832Re-query CCDS DB by Protein ID:NP_001171761Link to BLAST:NP_001171761.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001171761.1 1099 Q13621-3 1099 100% 0 0

Chromosomal Locations for CCDS 53940.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 15 (NC_000015.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 48207720 48208139 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48220634 48220765 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48220921 48220996 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48227079 48227174 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48229189 48229328 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48230393 48230503 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48232727 48232838 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48234877 48235004 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48241515 48241599 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48244753 48244904 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48246909 48247016 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48247337 48247460 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48249575 48249676 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48251615 48251770 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48255811 48255910 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48259200 48259311 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48267561 48267701 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48269658 48269764 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48274571 48274653 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48285106 48285249 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48288043 48288174 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48288405 48288516 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48291778 48291864 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48299140 48299275 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48301315 48301382 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 48302750 48302885 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3300 nt):
ATGTCACTGAACAACTCTTCCAATGTATTTCTGGATTCAGTGCCCAGTAATACCAATCGCTTTCAAGTTA
GT
GTCATAAATGAGAACCATGAGAGCAGTGCAGCTGCAGATGACAATACTGACCCACCACATTATGAAGA
A
ACCTCTTTTGGGGATGAAGCTCAGAAAAGACTCAGAATCAGCTTTAGGCCTGGGAATCAGGAGTGCTAT
GAC
AATTTCCTCCAAAGTGGAGAAACTGCTAAAACAGATGCCAGTTTTCACGCTTATGATTCTCACACAA
AC
ACATACTATCTACAAACTTTTGGCCACAACACCATGGATGCCGTTCCCAAGATAGAGTACTATCGTAA
C
ACCGGCAGCATCAGTGGGCCCAAGGTCAACCGACCCAGCCTGCTTGAGATTCACGAGCAACTCGCAAAG
AAT
GTGGCAGTCACCCCAAGTTCAGCTGACAGAGTTGCTAACGGTGATGGGATACCTGGAGATGAACAAG
CT
GAAAATAAGGAAGATGATCAAGCTGGTGTTGTGAAGTTTGGATGGGTGAAAGGTGTGCTGGTAAGATG
C
ATGCTGAACATCTGGGGAGTCATGCTCTTCATTCGCCTCTCCTGGATTGTTGGAGAAGCTGGAATTGGT
CTT
GGAGTCATCATCATTGGCCTAAGTGTGGTAGTAACGACACTCACAGGTATTTCTATGTCTGCTATTT
GC
ACGAATGGAGTAGTAAGAGGAGGTGGGGCCTACTATCTTATTTCCAGAAGTTTAGGGCCCGAGTTCGG
T
GGGTCAATAGGCCTGATCTTTGCTTTTGCTAATGCAGTGGCTGTTGCTATGTATGTGGTGGGATTTGCT
GAG
ACTGTAGTAGATCTTCTTAAGGAGAGTGATTCGATGATGGTGGATCCAACCAATGACATCCGGATTA
TA
GGCTCCATCACAGTGGTGATTCTTCTAGGAATTTCAGTAGCTGGAATGGAATGGGAGGCAAAGGCCCA
A
GTCATTCTTCTGGTCATTCTTCTAATTGCTATTGCAAACTTCTTCATTGGAACTGTCATTCCATCCAAC
AAT
GAGAAAAAGTCCAGAGGTTTCTTTAATTACCAAGCATCAATATTTGCAGAAAACTTTGGGCCACGCT
TC
ACAAAGGGTGAAGGCTTCTTCTCTGTCTTTGCCATTTTTTTCCCAGCAGCTACTGGGATTCTTGCTGG
T
GCCAATATCTCAGGAGATTTGGAGGATCCCCAAGATGCCATCCCCAGAGGAACCATGCTGGCCATTTTC
ATC
ACCACTGTTGCCTACTTAGGGGTTGCAATTTGTGTAGGGGCCTGTGTGGTCCGAGATGCCACCGGGA
AC
ATGAATGACACCATCATTTCTGGGATGAACTGCAATGGTTCAGCAGCATGTGGGTTGGGCTATGACTT
C
TCAAGATGTCGACATGAACCATGTCAGTACGGGCTGATGAACAATTTCCAGGTCATGAGCATGGTATCA
GGG
TTCGGCCCCCTCATCACTGCGGGAATCTTTTCTGCAACACTCTCCTCCGCCCTGGCCTCCCTTGTCA
GC
GCACCCAAAGTGTTCCAGGCTCTGTGCAAGGACAACATCTACAAAGCCCTGCAGTTTTTTGCAAAGGG
A
TATGGGAAAAACAATGAACCCCTGAGAGGATATATTCTCACTTTTCTTATAGCCATGGCATTTATTCTT
ATT
GCGGAACTGAACACCATTGCTCCCATCATCTCCAACTTTTTCCTGGCCTCATATGCACTTATTAATT
TC
TCCTGCTTCCATGCCTCTTATGCCAAATCTCCAGGATGGAGACCTGCGTATGGAATTTACAACATGTG
G
GTATCTCTTTTTGGAGCTGTTTTGTGCTGTGCAGTCATGTTTGTCATCAACTGGTGGGCAGCTGTCATC
ACC
TATGTCATTGAATTCTTCCTTTACGTCTATGTGACTTGTAAGAAGCCAGATGTGAACTGGGGCTCCT
CC
ACACAGGCTCTTTCCTACGTGAGTGCTTTAGACAATGCTCTGGAATTAACCACAGTGGAAGACCACGT
A
AAAAACTTCAGGCCCCAGTGCATTGTCTTAACAGGGGGACCCATGACAAGACCTGCTCTCCTGGACATA
ACT
CACGCCTTTACCAAGAACAGTGGCCTTTGCATCTGCTGTGAAGTCTTTGTGGGACCGCGCAAACTGT
GT
GTTAAGGAGATGAACAGTGGCATGGCGAAAAAACAGGCCTGGCTTATAAAGAACAAAATCAAGGCTTT
T
TATGCTGCAGTGGCGGCAGACTGTTTCAGGGATGGTGTCCGAAGTCTTCTTCAGGCCTCAGGCTTAGGA
AGA
ATGAAACCAAACACTCTGGTGATTGGATATAAGAAAAACTGGAGGAAAGCTCCCTTGACAGAGATTG
AG
AACTACGTGGGAATCATACATGATGCATTTGATTTTGAGATTGGCGTGGTTATAGTCAGAATCAGCCA
A
GGATTTGACATCTCTCAGGTTCTTCAGGTGCAAGAGGAATTAGAGAGATTAGAACAGGAGAGACTAGCA
TTG
GAAGCGACTATCAAAGATAATGAGTGTGAAGAGGAAAGTGGAGGCATCCGAGGCTTGTTTAAAAAAG
CT
GGCAAGTTGAACATTACTAAGACAACGCCTAAAAAAGATGGCAGCATTAACACAAGCCAGTCGATGCA
T
GTGGGAGAGTTCAACCAGAAACTGGTGGAAGCCAGCACTCAATTTAAAAAGAAACAAGAAAAAGGCACA
ATT
GATGTTTGGTGGTTGTTTGATGATGGAGGGTTAACACTTCTTATCCCCTATATCTTAACTCTCAGAA
AA
AAATGGAAAGACTGTAAATTAAGAATCTATGTGGGAGGGAAGATCAACCGCATTGAAGAAGAAAAAAT
T
GTAATGGCTTCCCTTCTGAGCAAATTTAGGATAAAATTTGCAGACATCCATATCATCGGTGACATCAAC
ATT
AGGCCAAACAAAGAGAGCTGGAAAGTCTTTGAAGAGATGATTGAACCATATCGTCTCCATGAAAGCT
GC
AAAGATTTAACAACTGCTGAGAAATTAAAAAGAGAAACTCCGTGGAAAATTACAGATGCAGAACTGGA
A
GCAGTCAAGGAAAAGAGTTACCGCCAAGTTCGACTGAATGAACTCTTACAGGAGCACTCCAGAGCTGCT
AAT
CTCATTGTCCTGAGCCTTCCCGTGGCAAGAAAGGGATCCATATCGGATTTGTTGTATATGGCTTGGT
TG
GAAATCCTCACAAAGAACCTCCCACCTGTCTTACTAGTTAGAGGAAATCACAAAAATGTCTTGACATT
T
TACTCTTAA


Translation (1099 aa):
MSLNNSSNVFLDSVPSNTNRFQVSVINENHESSAAADDNTDPPHYEETSFGDEAQKRLRISFRPGNQECY
D
NFLQSGETAKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSISGPKVNRPSLLEIHEQLAK

N
VAVTPSSADRVANGDGIPGDEQAENKEDDQAGVVKFGWVKGVL
VRCMLNIWGVMLFIRLSWIVGEAGIG
L
GVIIIGLSVVVTTLTGISMSAICTNGVVRG
GGAYYLISRSLGPEFGGSIGLIFAFANAVAVAMYVVGFA
E
TVVDLLK
ESDSMMVDPTNDIRIIGSITVVILLGISVAGMEWEAKAQVILLVILLIAIANFFIGTVIPSN
N
EKKSRGFFNYQ
ASIFAENFGPRFTKGEGFFSVFAIFFPAATGILAGANISGDLEDPQDAIPRGTMLAIF
I
TTVAYLGVAICV
GACVVRDATGNMNDTIISGMNCNGSAACGLGYDFSRCRHEPCQYGLMNNFQVMSMVS
G
FGPLITAGIFSATLSSALASLVSAPKVFQ
ALCKDNIYKALQFFAKGYGKNNEPLRGYILTFLIAMAFIL
I
AELNTIAPIISNFFLASYALINFSCFHASYAKSPGWRPAYGIYNMWVSLFGAVLCCAVMFVINWWAAVI
T
YVIEFFLYVYVTCKKP
DVNWGSSTQALSYVSALDNALELTTVEDHVKNFRPQCIVLTGGPMTRPALLDI
T
HAFTKNSGLCICCEVFV
GPRKLCVKEMNSGMAKKQAWLIKNKIKAFYAAVAADCFRDGVRSLLQASGLG
R
MKPNTLVIGYKKNWRKAPLTEIENYVGII
HDAFDFEIGVVIVRISQGFDISQVLQVQEELERLEQERLA
L
EATIKDNECEEESGGIRGLFKKAGKLNITKTTPKK
DGSINTSQSMHVGEFNQKLVEASTQFKKKQEKGT
I
DVWWLFDDG
GLTLLIPYILTLRKKWKDCKLRIYVGGKINRIEEEKIVMASLLSKFRIKFADIHIIGDIN
I
RPNKE
SWKVFEEMIEPYRLHESCKDLTTAEKLKRETPWKITDAELEAVKEKSYRQVRLNELLQEHSRAA
N
LIV
LSLPVARKGSISDLLYMAWLEILTKNLPPVLLVRGNHKNVLTFYS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser