NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS53609.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
53609.1 Public Homo sapiens 11 LDHA 22 109 92 CCDS HistoryNCBI Gene:3939Re-query CCDS DB by CCDS ID:53609.1Re-query CCDS DB by GeneID:3939See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 8, NCBI annotation release 37.2, Ensembl annotation release 62

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 53609.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000540430.5 ENSP00000445175.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000540430.5Link to Ensembl Protein Viewer:ENSP00000445175.1Re-query CCDS DB by Nucleotide ID:ENST00000540430Re-query CCDS DB by Protein ID:ENSP00000445175
Original member NCBI NM_001165414.1 NP_001158886.1 Updated not alive Link to Nucleotide Sequence:NM_001165414.1Link to Protein Sequence:NP_001158886.1Re-query CCDS DB by Nucleotide ID:NM_001165414Re-query CCDS DB by Protein ID:NP_001158886
Current member NCBI NM_001165414.2 NP_001158886.1 Accepted alive Link to Nucleotide Sequence:NM_001165414.2Link to Protein Sequence:NP_001158886.1Re-query CCDS DB by Nucleotide ID:NM_001165414Re-query CCDS DB by Protein ID:NP_001158886Link to BLAST:NP_001158886.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001158886.1 361 P00338-3 361 100% 0 0

Chromosomal Locations for CCDS 53609.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 18396548 18396610 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 18396819 18396968 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 18399431 18399548 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 18400837 18401010 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 18402840 18403013 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 18403694 18403811 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 18405449 18405572 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 18407117 18407281 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1086 nt):
ATGGGTGAACCCTCAGGAGGCTATACTTACACCCAAACGTCGATATTCCTTTTCCACGCTAAGATTCCTT
TT
GGTTCCAAGTCCAATATGGCAACTCTAAAGGATCAGCTGATTTATAATCTTCTAAAGGAAGAACAGAC
C
CCCCAGAATAAGATTACAGTTGTTGGGGTTGGTGCTGTTGGCATGGCCTGTGCCATCAGTATCTTAATG
AAG
GACTTGGCAGATGAACTTGCTCTTGTTGATGTCATCGAAGACAAATTGAAGGGAGAGATGATGGATC
TC
CAACATGGCAGCCTTTTCCTTAGAACACCAAAGATTGTCTCTGGCAAAGACTATAATGTAACTGCAAA
C
TCCAAGCTGGTCATTATCACGGCTGGGGCACGTCAGCAAGAGGGAGAAAGCCGTCTTAATTTGGTCCAG
CGT
AACGTGAACATCTTTAAATTCATCATTCCTAATGTTGTAAAATACAGCCCGAACTGCAAGTTGCTTA
TT
GTTTCAAATCCAGTGGATATCTTGACCTACGTGGCTTGGAAGATAAGTGGTTTTCCCAAAAACCGTGT
T
ATTGGAAGCGGTTGCAATCTGGATTCAGCCCGATTCCGTTACCTAATGGGGGAAAGGCTGGGAGTTCAC
CCA
TTAAGCTGTCATGGGTGGGTCCTTGGGGAACATGGAGATTCCAGTGTGCCTGTATGGAGTGGAATGA
AT
GTTGCTGGTGTCTCTCTGAAGACTCTGCACCCAGATTTAGGGACTGATAAAGATAAGGAACAGTGGAA
A
GAGGTTCACAAGCAGGTGGTTGAGAGTGCTTATGAGGTGATCAAACTCAAAGGCTACACATCCTGGGCT
ATT
GGACTCTCTGTAGCAGATTTGGCAGAGAGTATAATGAAGAATCTTAGGCGGGTGCACCCAGTTTCCA
CC
ATGATTAAGGGTCTTTACGGAATAAAGGATGATGTCTTCCTTAGTGTTCCTTGCATTTTGGGACAGAA
T
GGAATCTCAGACCTTGTGAAGGTGACTCTGACTTCTGAGGAAGAGGCCCGTTTGAAGAAGAGTGCAGAT
ACA
CTTTGGGGGATCCAAAAGGAGCTGCAATTTTAA


Translation (361 aa):
MGEPSGGYTYTQTSIFLFHAKIPFGSKSNMATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILM
K
DLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQ
R
NVNIFKFIIPNVVKYSPNCKLLIVSNP
VDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVH
P
LSCHGWVLGEHGDSS
VPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWA
I
GLSVADLAESIMKNLRRVHPVSTMIK
GLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSAD
T
LWGIQKELQF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser