NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS53373.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
53373.1 Public Homo sapiens 1 GBA 20 108 85 CCDS HistoryNCBI Gene:2629Re-query CCDS DB by CCDS ID:53373.1Re-query CCDS DB by GeneID:2629See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 8, NCBI annotation release 37.2, Ensembl annotation release 62

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 53373.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000428024 ENSP00000397986 Accepted alive Link to Ensembl Transcript Viewer:ENST00000428024Link to Ensembl Protein Viewer:ENSP00000397986Re-query CCDS DB by Nucleotide ID:ENST00000428024Re-query CCDS DB by Protein ID:ENSP00000397986
Original member Current member EBI,WTSI OTTHUMT00000471534 OTTHUMP00000273843 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000471534Link to Vega Protein Viewer:OTTHUMP00000273843Re-query CCDS DB by Nucleotide ID:OTTHUMT00000471534Re-query CCDS DB by Protein ID:OTTHUMP00000273843
Original member Current member NCBI NM_001171811.1 NP_001165282.1 Accepted alive Link to Nucleotide Sequence:NM_001171811.1Link to Protein Sequence:NP_001165282.1Re-query CCDS DB by Nucleotide ID:NM_001171811Re-query CCDS DB by Protein ID:NP_001165282Link to BLink:NP_001165282.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001165282.1 449 P04062-4 449 100% 0 0

Chromosomal Locations for CCDS 53373.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 155234995 155235100 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 155235195 155235311 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 155235681 155235844 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 155236245 155236469 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 155237341 155237578 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 155238134 155238306 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 155238517 155238650 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 155239616 155239762 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 155239886 155239931 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1350 nt):
ATGGAGCTGAGTATGGGGCCCATCCAGGCTAATCACACGGGCACAGGCCTGCTACTGACCCTGCAGCCAG
AA
CAGAAGTTCCAGAAAGTGAAGGGATTTGGAGGGGCCATGACAGATGCTGCTGCTCTCAACATCCTTGC
C
CTGTCACCCCCTGCCCAAAATTTGCTACTTAAATCGTACTTCTCTGAAGAAGGAATCGGATATAACATC
ATC
CGGGTACCCATGGCCAGCTGTGACTTCTCCATCCGCACCTACACCTATGCAGACACCCCTGATGATT
TC
CAGTTGCACAACTTCAGCCTCCCAGAGGAAGATACCAAGCTCAAGATACCCCTGATTCACCGAGCCCT
G
CAGTTGGCCCAGCGTCCCGTTTCACTCCTTGCCAGCCCCTGGACATCACCCACTTGGCTCAAGACCAAT
GGA
GCGGTGAATGGGAAGGGGTCACTCAAGGGACAGCCCGGAGACATCTACCACCAGACCTGGGCCAGAT
AC
TTTGTGAAGTTCCTGGATGCCTATGCTGAGCACAAGTTACAGTTCTGGGCAGTGACAGCTGAAAATGA
G
CCTTCTGCTGGGCTGTTGAGTGGATACCCCTTCCAGTGCCTGGGCTTCACCCCTGAACATCAGCGAGAC
TTC
ATTGCCCGTGACCTAGGTCCTACCCTCGCCAACAGTACTCACCACAATGTCCGCCTACTCATGCTGG
AT
GACCAACGCTTGCTGCTGCCCCACTGGGCAAAGGTGGTACTGACAGACCCAGAAGCAGCTAAATATGT
T
CATGGCATTGCTGTACATTGGTACCTGGACTTTCTGGCTCCAGCCAAAGCCACCCTAGGGGAGACACAC
CGC
CTGTTCCCCAACACCATGCTCTTTGCCTCAGAGGCCTGTGTGGGCTCCAAGTTCTGGGAGCAGAGTG
TG
CGGCTAGGCTCCTGGGATCGAGGGATGCAGTACAGCCACAGCATCATCACGAACCTCCTGTACCATGT
G
GTCGGCTGGACCGACTGGAACCTTGCCCTGAACCCCGAAGGAGGACCCAATTGGGTGCGTAACTTTGTC
GAC
AGTCCCATCATTGTAGACATCACCAAGGACACGTTTTACAAACAGCCCATGTTCTACCACCTTGGCC
AC
TTCAGCAAGTTCATTCCTGAGGGCTCCCAGAGAGTGGGGCTGGTTGCCAGTCAGAAGAACGACCTGGA
C
GCAGTGGCACTGATGCATCCCGATGGCTCTGCTGTTGTGGTCGTGCTAAACCGCTCCTCTAAGGATGTG
CCT
CTTACCATCAAGGATCCTGCTGTGGGCTTCCTGGAGACAATCTCACCTGGCTACTCCATTCACACCT
AC
CTGTGGCGTCGCCAGTGA


Translation (449 aa):
MELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIGYNI
I
RVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKLK
IPLIHRALQLAQRPVSLLASPWTSPTWLKTN
G
AVNGKGSLKGQPGDIYHQTWARYFV
KFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGFTPEHQRD
F
IARDLGPTLANSTHHNVRLLMLDDQRLLLPHWAKV
VLTDPEAAKYVHGIAVHWYLDFLAPAKATLGETH
R
LFPNTMLFASEACVGSKFWEQSVRLGSWDRGMQYSHSIIT
NLLYHVVGWTDWNLALNPEGGPNWVRNFV
D
SPIIVDITKDTFYKQPMFYHLGHF
SKFIPEGSQRVGLVASQKNDLDAVALMHPDGSAVVVVLNRSSKDV
P
LTIKDPAVGFLETISPGYSIHTYLWRRQ




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser