NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS53285.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
53285.1 Public Homo sapiens 1 RHD 22 109 92 CCDS HistoryNCBI Gene:6007Re-query CCDS DB by CCDS ID:53285.1Re-query CCDS DB by GeneID:6007See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 8, NCBI annotation release 37.2, Ensembl annotation release 62

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 53285.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000454452.6 ENSP00000413849.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000454452.6Link to Ensembl Protein Viewer:ENSP00000413849.2Re-query CCDS DB by Nucleotide ID:ENST00000454452Re-query CCDS DB by Protein ID:ENSP00000413849
Original member Current member NCBI NM_001127691.2 NP_001121163.1 Accepted alive Link to Nucleotide Sequence:NM_001127691.2Link to Protein Sequence:NP_001121163.1Re-query CCDS DB by Nucleotide ID:NM_001127691Re-query CCDS DB by Protein ID:NP_001121163Link to BLAST:NP_001121163.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001121163.1 321 Q02161-2 321 100% 0 0

Chromosomal Locations for CCDS 53285.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 25272548 25272695 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 25284573 25284759 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 25290641 25290791 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 25300946 25301093 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 25301520 25301686 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 25303322 25303459 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 25328898 25328924 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (966 nt):
ATGAGCTCTAAGTACCCGCGGTCTGTCCGGCGCTGCCTGCCCCTCTGGGCCCTAACACTGGAAGCAGCTC
TC
ATTCTCCTCTTCTATTTTTTTACCCACTATGACGCTTCCTTAGAGGATCAAAAGGGGCTCGTGGCATC
C
TATCAAGTTGGCCAAGATCTGACCGTGATGGCGGCCATTGGCTTGGGCTTCCTCACCTCGAGTTTCCGG
AGA
CACAGCTGGAGCAGTGTGGCCTTCAACCTCTTCATGCTGGCGCTTGGTGTGCAGTGGGCAATCCTGC
TG
GACGGCTTCCTGAGCCAGTTCCCTTCTGGGAAGGTGGTCATCACACTGTTCAGTATTCGGCTGGCCAC
C
ATGAGTGCTTTGTCGGTGCTGATCTCAGTGGATGCTGTCTTGGGGAAGGTCAACTTGGCGCAGTTGGTG
GTG
ATGGTGCTGGTGGAGGTGACAGCTTTAGGCAACCTGAGGATGGTCATCAGTAATATCTTCAACACAG
AC
TACCACATGAACATGATGCACATCTACGTGTTCGCAGCCTATTTTGGGCTGTCTGTGGCCTGGTGCCT
G
CCAAAGCCTCTACCCGAGGGAACGGAGGATAAAGATCAGACAGCAACGATACCCAGTTTGTCTGCCATG
CTG
GGCGCCCTCTTCTTGTGGATGTTCTGGCCAAGTTTCAACTCTGCTCTGCTGAGAAGTCCAATCGAAA
GG
AAGAATGCCGTGTTCAACACCTACTATGCTGTAGCAGTCAGCGTGGTGACAGCCATCTCAGGGTCATC
C
TTGGCTCACCCCCAAGGGAAGATCAGCAAGACTTATGTGCACAGTGCGGTGTTGGCAGGAGGCGTGGCT
GTG
GGTACCTCGTGTCACCTGATCCCTTCTCCGTGGCTTGCCATGGTGCTGGGTCTTGTGGCTGGGCTGA
TC
TCCGTCGGGGGAGCCAAGTACCTGCCGTTTCCTCATTTGGCTGTTGGATTTTAA


Translation (321 aa):
MSSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAAIGLGFLTSSFR
R
HSWSSVAFNLFMLALGVQWAILLDGFLSQFPSGKVVITLF
SIRLATMSALSVLISVDAVLGKVNLAQLV
V
MVLVEVTALGNLRMVISNIFN
TDYHMNMMHIYVFAAYFGLSVAWCLPKPLPEGTEDKDQTATIPSLSAM
L
GALFLWMFWPSFNSALLRSPIERKNAVFNTYYAVAVSVVTAISGSSLAHPQGKISKTYVHSAVLAGGVA
V
GTSCHLIPSPWLAMVLGLVAGLISVGGAKYLP
FPHLAVGF



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser