NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS53145.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
53145.1 Public Mus musculus X Eda 23 108 98 CCDS HistoryNCBI Gene:13607Re-query CCDS DB by CCDS ID:53145.1Re-query CCDS DB by GeneID:13607See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 53145.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000113781.7 ENSMUSP00000109411.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000113781.7Link to Ensembl Protein Viewer:ENSMUSP00000109411.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000113781Re-query CCDS DB by Protein ID:ENSMUSP00000109411
Original member Current member NCBI NM_001177941.1 NP_001171412.1 Accepted alive Link to Nucleotide Sequence:NM_001177941.1Link to Protein Sequence:NP_001171412.1Re-query CCDS DB by Nucleotide ID:NM_001177941Re-query CCDS DB by Protein ID:NP_001171412Link to BLAST:NP_001171412.1

Chromosomal Locations for CCDS 53145.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 99975781 99976176 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 100309994 100310099 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 100389702 100389881 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 100391341 100391375 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 100392333 100392384 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 100395028 100395143 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 100396905 100397156 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1137 nt):
ATGGGCTACCCAGAGGTAGAGCGCAGGGAACCCCTGCCTGCGGCAGCGCCAAGGGAGCGGGGCAGCCAGG
GC
TGCGGCTGTCGCGGGGCCCCTGCTCGGGCGGGCGAAGGGAACAGCTGCCGGCTCTTCCTGGGTTTCTT
T
GGCCTCTCGCTGGCCCTCCACCTGCTGACGCTGTGCTGCTACCTAGAGTTGCGGTCCGAATTGCGGCGG
GAA
CGGGGAACCGAGTCCCGCCTCGGTGGCCCGGGTGCTCCTGGCACCTCTGGCACCCTAAGCAGCCCTG
GG
AGCCTCGACCCGGTGGGTCCCATCACCCGCCACCTGGGGCAGCCGTCCTTTCAACAGCAGCCTTTGGA
A
CCGGGAGAAGATCCACTCCCCCCTGACTCCCAGGACCGGCACCAGATGGCCCTCCTGAATTTCTTCTTT
CCT
GATGAAAAGGCATATTCTGAAGAGGAAAGTAGGCGTGTTCGCCGCAATAAGAGAAGCAAAAGTGGTG
AA
GGAGCAGATGGAAAGAAGGCAGGGCCACCTGGGCCCAACGGCCCCCCAGGACCTCCAGGACCTCCGGG
A
CCCCAGGGACCTCCAGGGATTCCAGGAATTCCTGGGATTCCAGGAACAACTGTTATGGGACCACCTGGC
CCA
CCTGGCCCTCCTGGTCCTCAAGGACCCCCTGGCCTCCAAGGACCTTCTGGTGCTGCTGATAAAACTG
GA
ACTCGGGAAAATCAGCCAGCTGTGGTGCATCTGCAGGGCCAAGGGTCAGCAATTCAAGTCAAAAATGG
T
GGAGTGCTCAATGACTGGTCTCGCATCACTATGAACCCTAAGGTGTTTAAACTACATCCCCGCAGCGGG
GAG
CTGGAGGTACTGGTGGACGGCACCTACTTCATCTATAGTCAGGTCTACTACATCAACTTCACTGACT
TT
GCCAGCTACGAGGTGGTGGTGGATGAGAAGCCCTTCCTGCAGTGCACCCGCAGCATTGAGACAGGGAA
G
ACCAACTACAACACTTGCTATACTGCAGGCGTGTGCCTCCTCAAGGCCAGGCAGAAAATCGCCGTGAAG
ATG
GTGCACGCTGACATCTCTATCAATATGAGCAAGCACACCACCTTCTTCGGGGCCATCAGGCTGGGCG
AA
GCCCCTGCATCCTAG


Translation (378 aa):
MGYPEVERREPLPAAAPRERGSQGCGCRGAPARAGEGNSCRLFLGFFGLSLALHLLTLCCYLELRSELRR
E
RGTESRLGGPGAPGTSGTLSSPGSLDPVGPITRHLGQPSFQQQPLEPGEDPLPPDSQDRHQ
MALLNFFF
P
DEKAYSEEESRRVRRNKRSKSGEGAD
GKKAGPPGPNGPPGPPGPPGPQGPPGIPGIPGIPGTTVMGPPG
P
PGPPGPQGPPGLQGPS
GAADKTGTRENQPAVVHLQGQGSAIQVKNGGVLNDWSRITMNPKVFKLHPRSG
E
LEVLVDGTYFIYSQ
VYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVK
M
VHADISINMSKHTTFFGAIRLGEAPAS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser