NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS53128.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
53128.1 Public Mus musculus X Il1rapl1 23 108 98 CCDS HistoryNCBI Gene:331461Re-query CCDS DB by CCDS ID:53128.1Re-query CCDS DB by GeneID:331461See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 53128.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000078875.7 ENSMUSP00000077915.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000078875.7Link to Ensembl Protein Viewer:ENSMUSP00000077915.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000078875Re-query CCDS DB by Protein ID:ENSMUSP00000077915
Original member Current member EBI,WTSI ENSMUST00000113966.7 ENSMUSP00000109599.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000113966.7Link to Ensembl Protein Viewer:ENSMUSP00000109599.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000113966Re-query CCDS DB by Protein ID:ENSMUSP00000109599
Original member Current member NCBI NM_001160403.2 NP_001153875.1 Accepted alive Link to Nucleotide Sequence:NM_001160403.2Link to Protein Sequence:NP_001153875.1Re-query CCDS DB by Nucleotide ID:NM_001160403Re-query CCDS DB by Protein ID:NP_001153875Link to BLAST:NP_001153875.1

Chromosomal Locations for CCDS 53128.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 86747242 86747960 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 86748341 86748511 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 86762030 86762173 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 86785293 86785438 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 86787716 86787848 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 87046696 87046770 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 87300585 87300738 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 87304764 87304950 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 87419023 87419302 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 87890154 87890235 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2091 nt):
ATGAAAGCTCCGATCCCACATTTGATTCTCTTATATGCTACTTTCACTCAGAGTCTGAAGGTTGTGACTA
AA
AGAGGTTCTGCTGATGGATGCACAGATTGGTCTGTTGATATCAAGAAGTACCAAGTTTTGGTGGGAGA
A
CCTGTTAGAATCAAGTGTGCACTCTTTTATGGTTATATAAGAACAAACTACTCGCTCGCCCAAAGTGCT
GGA
CTCAGCTTAATGTGGTATAAAAGCTCTGGTCCAGGAGATTTTGAAGAGCCTATCGCCTTTGATGGAA
GT
AGAATGAGCAAAGAGGAAGATTCCATTTGGTTCAGACCAACATTACTACAGGACAGTGGGCTTTATGC
C
TGTGTCATCAGGAATTCCACATACTGTATGAAAGTCTCCATCTCACTGACAGTGGGAGAAAATGACACT
GGA
CTTTGCTACAATTCCAAGATGAAGTACTTTGAAAAAGCTGAACTTAGCAAAAGCAAGGAAATTTCAT
GC
CGAGACATAGAGGACTTTTTATTACCAACCAGGGAACCTGAAATCCTTTGGTACAAGGAATGTAGAAC
A
AAAGCATGGAGACCAAGTATTGTCTTCAAAAGAGATACCTTGCTTATAAAAGAAGTCAAAGAAGATGAC
ATT
GGAAACTATACCTGTGAATTAAAATACGGAGGCTTTGTTGTGAGAAGAACGACTGAGTTAACTGTTA
CA
GCTCCTCTAACTGATAAGCCACCTAAGCTTTTGTATCCCATGGAAAGTAAACTGACAGTTCAGGAGAC
T
CAACTAGGTGGCTCAGCCAACCTCACCTGCAGAGCTTTCTTTGGGTACAGTGGAGATGTCAGTCCTTTA
ATT
TACTGGATGAAAGGAGAGAAATTTATTGAAGATCTGGATGAAAATAGAGTTTGGGAAAGTGACATTA
G
A
ATCCTTAAGGAACATCTTGGAGAACAGGAAGTTTCTATTTCATTAATTGTTGACTCCGTGGAAGAAGG
T
GACCTGGGGAACTATTCCTGTTATGTTGAAAATGGAAACGGACGTCGGCATGCCAGTGTTCTCCTTCAT
AAA
CGAGAGTTAATGTACACCGTTGAACTTGCTGGAGGGCTTGGCGCTATTCTCTTGCTGCTCATCTGTT
CG
GTGACCATATATAAATGTTACAAGATAGAAATCATGCTCTTCTACAGGAATCATTTTGGAGCTGAGGA
A
CTGGATGGAGATAACAAAGATTATGATGCCTATCTGTCATATACCAAAGTGGATCCTGACCAGTGGAAT
CAA
GAGACTGGGGAAGAAGAACGTTTTGCCCTTGAAATCCTCCCTGATATGCTTGAAAAGCATTATGGAT
AT
AAGTTGTTTATACCAGATAGAGATCTGATCCCAACTGGAACATACATTGAAGATGTGGCTAGATGCGT
A
GATCAAAGTAAGCGGCTGATTATTGTCATGACCCCAAATTATGTAGTTCGAAGGGGCTGGAGCATCTTT
GAG
CTGGAAACGAGACTTCGAAACATGCTTGTGACTGGAGAAATTAAAGTGATACTGATTGAATGCAGCG
AA
CTCCGAGGAATTATGAACTACCAGGAGGTGGAGGCCCTCAAGCATACCATCAAGCTTCTGACGGTTAT
T
AAATGGCATGGACCAAAATGCAACAAGTTGAACTCGAAGTTCTGGAAACGTTTACAGTACGAAATGCCT
TTT
AAGAGGATAGAACCCATTACACATGAGCAGGCTTTAGATGTCAGTGAGCAGGGGCCTTTTGGGGAGC
TG
CAGACTGTCTCGGCCATTTCAATGGCTGCAGCCACCTCCACAGCTCTAGCCACTGCCCATCCAGATCT
C
CGTTCTACCTTTCATAACACCTACCATTCACAAATGCGTCAGAAACACTACTATCGAAGCTATGAGTAC
GAC
GTACCTCCTACGGGCACCCTGCCACTTACCTCCATAGGAAATCAGCATACCTACTGTAACATCCCTA
TG
ACACTCATCAATGGGCAGCGGCCACAGACAAAGTCGAACAGGGAGCCGAATCCAGACGAAGCCCACAC
A
AACAGTGCCATCCTGCCGTTGTTGCCAAGGGAGACCAGTATATCCAGTGTGATCTGGTGA


Translation (696 aa):
MKAPIPHLILLYATFTQSLKVVTKRGSADGCTDWSVDIKKYQVLVGEPVRIKCALFYGYIRTNYSLAQSA
G
LSLMWYKSSGPGDFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVI
RNSTYCMKVSISLTVGENDT
G
LCYNSKMKYFEKAELSKSKEISCRDIEDFLLPTREPEILWYK
ECRTKAWRPSIVFKRDTLLIKEVKEDD
I
GNYTCELKYGGFVVRRTTELTVT
APLTDKPPKLLYPMESKLTVQETQLGGSANLTCRAFFGYSGDVSPL
I
YWMKGEKFIEDLDENRVWESDI
RILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLH
K
R
ELMYTVELAGGLGAILLLLICSVTIYKCYKIEIMLFYRNHFGAEELDGDNKDYDAYLSYTKVDPDQWN
Q
ETGEEERFALEILPDMLEKHYGYKLFIPDRDLIPTG
TYIEDVARCVDQSKRLIIVMTPNYVVRRGWSIF
E
LETRLRNMLVTGEIKVILIECSELRGIMNYQEVEALKHTIKLLTVIKWHGPKCNKLNSKFWKRLQYEMP
F
KRIEPITHEQALDVSEQGPFGELQTVSAISMAAATSTALATAHPDLRSTFHNTYHSQMRQKHYYRSYEY
D
VPPTGTLPLTSIGNQHTYCNIPMTLINGQRPQTKSNREPNPDEAHTNSAILPLLPRETSISSVIW




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser