NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS52939.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
52939.1 Public Mus musculus 9 Nbeal2 23 108 98 CCDS HistoryNCBI Gene:235627Re-query CCDS DB by CCDS ID:52939.1Re-query CCDS DB by GeneID:235627See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 52939.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000167320.7 ENSMUSP00000128586.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000167320.7Link to Ensembl Protein Viewer:ENSMUSP00000128586.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000167320Re-query CCDS DB by Protein ID:ENSMUSP00000128586
Original member Current member NCBI NM_183276.2 NP_899099.2 Accepted alive Link to Nucleotide Sequence:NM_183276.2Link to Protein Sequence:NP_899099.2Re-query CCDS DB by Nucleotide ID:NM_183276Re-query CCDS DB by Protein ID:NP_899099Link to BLAST:NP_899099.2

Chromosomal Locations for CCDS 52939.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 110625125 110625226 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110625329 110625464 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110625734 110625882 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110625963 110626121 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110626217 110626333 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110626536 110626630 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110626733 110626905 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110627078 110627187 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110627269 110627358 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110627807 110627923 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110627992 110628089 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110628187 110628304 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110628394 110628503 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110628619 110628749 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110628878 110629018 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110629116 110629240 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110629570 110629665 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110629770 110630086 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110630190 110630353 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110630784 110630919 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110631001 110631125 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110631342 110631499 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110631620 110631769 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110631858 110632202 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110632290 110632427 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110632735 110632894 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110632977 110633155 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110633682 110634197 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110634364 110634470 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110634713 110634872 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110635046 110635204 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110635298 110635451 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110635614 110635716 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110635861 110636020 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110636295 110636428 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110636562 110636736 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110636891 110636983 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110637075 110637157 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110637364 110637685 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110637879 110637998 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110638092 110638224 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110638305 110638906 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110639294 110639392 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110639780 110639863 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110641411 110641491 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110641771 110641877 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110642011 110642293 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110642385 110642470 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110643712 110643794 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110644009 110644127 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110644220 110644301 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110644417 110644545 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110644630 110644718 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110653897 110653947 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (8253 nt):
ATGGCCGCCTCGGAGCGGCTCTACGAGTTGTGGCTGCTCTACTACGCGCAGAAGGACCTTGGTTACCTGC
AG
CAATGGCTGAAGGCCTTTGTGGGTGTCTTCGAGAAGACTATCTCGTTATCCTCCCTGGAACCTCGAAG
G
CCAGAGGAGGCAGGTGCGGAAGTGCCTCTGCTACCCCTAGATGCTCTACATGCACTAGCGGAGCAGCTG
GAC
CAGGACGACCTGGATCAAGCCCTGCTGTTGCTGAAGCTCTTTATCATCCTCTGCAGGAACCTAGAGA
AC
GTAGAGGCTGGTTGGGGCCAGGTACTGGTGCCCCGTGTGCTGGCGTTGCTCACTGTATTGATGGCTGA
G
CTGAAAGGATCCTCACAGGAGAGCCATGGGACCCAGCTAGAGAACGTGGCCCTGCATGCCCTGCTCCTT
TGT
GAAGGGCTCTTTGACCCTTACCAGACTTGGCGGCGCCAGCTCACTGGGGAAGTCATCAGCTCCAAGG
AG
AAGAGCAAATACAAGTTCCCTCCGGCCGCCTTGCCCTGTGAATTTGGAGCCTTCTTCCAAGAGAACCT
G
CAGGATGCAGAGCGTTTGCCTCCCACGTTGCTGTTGCGGCTCATCCACCTCTTTGGTGCCATCCTTGCA
GGA
GGAAAGGCGAATGGGCAGATGGCTGTGAGTGCTGGCTCTGTGCAGGGACTGCTAGGTGTGGTGCGGG
GC
TGGGGCCGTGGCCCTGCTCAGGACCCCCAGCAGGTGCCACTGGCTCTGAGAGCACTGGTGGGTGCAGT
G
CACGTTCTGCATGCTAGCCGAGCACCACCCCGAGGACCAGAACTGCGTACCCTGCTTGAGGGTTACTTC
CAC
ATTCTCAATGCTGACTGGCCAACTAGTCCAAGTTCAAGCCCCGAAGAGGCCCTTGTCACCCTGCGGG
TC
AGCATGCTCGATGCTATCCCCATGATGCTGGCGTGTGAGGACCGGCCAGTGCTACAAGCCACCTTCCT
T
AGCAACAATTGCTTTGAGCATCTTATTCGCCTCATCCAGAACAGCAAGCTTTACCTGCAGGCCCGGGCG
CCC
CCTGAGGGGGACAGTGACCTGGCTACCTGGTTACTGACTGAGCCCGATGTCCAGAAGGTGCTTGACC
AG
GACACCGATGCCATCGCAGTGCACGTGGTCAGAGTGCTGACCTGCATCATGAGTGGCTCCCCTTCGGC
C
AAGGAGGTGTTCAAGGAGCGCATTGGCTACCAGCACCTGCAGGAGGTCCTGCAGAGCCACGGACCCCCT
ACC
CACAGGCTGTTGCAGGAATTGCTCAACATGGCTGTGGAGGGTGACCACAGCATGCACCCACCTCCAC
CA
ATCCGCAACGAGCAGCCAGTGCTGGTGCTGATGCAGTGGCTACCAGCACTGCCCACAGCTGAGCTGCG
C
CTCTTCCTGGCACAACGCCTCTGGTGGCTCTGTGACAGCTGCCCTGCCAGTCGCACCACCTGTGTGCAA
GCA
GGCCTGGTGGGCTACCTGTTAGAGACACTTAACACGGGGACAGCCCTGGGAGCCCGCTGCCAGGAGC
AG
CTGTTAGCCTTGCTGCAAGCTCTGGGTCGAGTGTCACTACGGCCCTTGGAGCTGCGTCGCCTGCTGCG
C
CCCCCACCGGGGCTGGACTCAGAGTCAAGTGGAAATGAATCTCAGAAGGCTCGCCATGCAGGCGCCGTC
ATC
CGGGCACTGTCGGGCATGGCCCGGCACCGGGGTCCTGCACGTGCCCTGCGCTACTTTGACCTCACGC
CC
AGCATGGCTGGCATCATGGTGCCGCCCGTGCAGCGGTGGCCAGGAGCCGGCTTTACCTTCCATGCCTG
G
CTGTGTCTACAATCGTCAGAGGCGGTTCCTACCTCAGCTCCCAGCCGGCCCCTCCAGCGGAAACAACTG
TAC
AGCTTCTTCACCAGCAGTGGCTCAGGGTTCGAAGCCTTCTTCACGGCAGCTGGCACCCTGGTGGTGG
CC
GTGTGCACACGGAAGGAGTACGTGACCGTGAACTTGCCCGAAGTGTCCTTCGCGGATTCTGCCTGGCA
C
TGCGTGGCCATTGTGCATGTGCCCGGGCGCCGACCCTTCAGTCAGAACCTGGTCAATGTCTTCAAAGAT
GGC
CATCTGGTCAAGACAGTACCTTTTCGCTTTCCCTCCCTCAGTGAGCCTTTCTCCTCCTGCTGTATTG
GT
TCTGCTGGGCACCGCACAACGACAACCACCACAGGGCTTCCCGCGTCATCAGTCTCCACAGCCTTGGC
T
CACACTCACCCTTCCCTCACCCGCTCCCAGTCAGTCCCAGCCTCCACAGGCCTGGGCTGGGGGCCTGGA
CTG
GGGACCCCTCTGCAGGAGGGCAGCGTCAGCTCTACCCTCGCAGGCACCCAGGACACTCGGTGGGGAA
GC
CCCACATCTCTGGAGGGTGAGCTGGGGGCTGTAGCCATCTTCCATGAAGCCCTGCAACCATCTGCCCT
A
AGGGTCCTGTGTAGCCTGGGGCCCAATGAGCCAGCACCCTTCAAGCCTGAGGGTGAACTACATGAGTTT
GGC
ACCAAGTTGCTCCTCCATTATTCACCGCAGGCCTGTAAGAACAATATCTGTCTGGACCTGTCCCCTG
GC
CATGGGCTGGATGGCCGTCTGACAGGACATAGGGTGGAGACATGGGACGTGAAGGATGTGGTGAACTG
C
GTAGGGGGCATGGGTGTTCTGCTGCCCTTGCTGGAGCGAGTGGCTGTGCAGCCCCAGGAGGCCGAGGCC
GGC
CCGTGTGAAACACACGACCTCGTAGGACCTGAGCTGACCTCAGGCCGCAACACTCAGGGCCTGCTTC
TC
CCCCTGGGCAAGTCCTCAGAGGACCGGATGGAGAGGAACGCAGTGGCTGCCTTTCTCCTGATGCTTCG
G
AACTTCCTGCAGAACCACACCGTGAATCAGGAGAGCCTGGTGCAGTGCCAGGGTCCTGCCATCATAGGG
GCT
CTCCTGCGCAAGGTCCCCAGTTCGGCCATGGATATGAATGTGCTCATGTCTGCCCAGCTGCTGATGG
AG
CAGGCGGCTGCTGATGGCGGTGGGCCCCTCCTCTACCTGCTCTATCAGCACCTGCTCTTCAACTTTCA
C
CTCTGGACCCTCAGTGACTTCGCTGTGCGCCTGGGTCACATCCAGTACATGTCTAGCATGGTCCGTGAG
CAC
AGACAGAAACTTCGGAAGAAGTACGGAGTTCAGTTCCTCCTCGATGCTCTGCGCACGCACTACAGCC
CG
CAGCGCGAGCGCCCCCTAGCGGCAGACGACCTGCGTACAGTACAGACTTCCCTTTTGGGTCTGGTGCG
T
GAGTTCTTGGTTAGGAACTTCTCGGTGGAAGACATGCAGGTTGTATTGAACTTTTTGGCAGCTACCGGT
GAC
GATGGCCAGGTGGTGGGCACCCTGGAGCTGTTGCTAACCCTGCTTCAGGGTTCTCCAGTGCAAGACC
CC
TTGGCCGCCTTCCTGCTGGAGCTGGGGAACCTTGAGGTGCTGCTCGCACTGCTGGTGCGGCCAAAGTC
A
ACGCCCCTTTTGACCGACAGGGTCTGCAAGATCTTGCGAAGACTGCAGCAGAATGAGCGGTTACCCGAG
CGG
AACCGCCAGAGGATACGGCTGCACGACTGTGGTCTCCAGGGTCTTGTTGCTAGCTTGTCGGAAGAGA
GC
ATCTCTCCCCAGCTCTGCCAGGGCCTTTATAAGCTGTTTGTAGGGACAGTCCCTCAGGTTGTATCTCC
A
GACTGCCTGAATCTCTCAGATTTGTTGGCTGTTGTACAGCTGTCCCTCCAGGCTGACCTCAGTGTCCGC
CTA
GACATCTGCCGTCAGCTCTTTTACCTCATCTACGGACAGCCAGACGTCGTTCGGCTGCTGGCCCGAC
AA
GCTGGCTGGCAGGATGTGCTGACGCGGCTGTATGTCCTCGAGGCTGCCACAGACAGTAGTCCCCCACG
C
TTCCTCCCAGAGCTGCCGATCTCTTCAGAGCTGGCCCTATCTCCGCCGCCCACTGAGTTGCCCGCTGAC
TCT
TCTGACGTCTTCCTGCCTTCAGAGTCCCCTTGCCCTGACCAGGATGCTTTCTACCAGGCCCTCTCCC
CG
TTCAGTACACCCTTTGACCTGGGTTTGGAACGGGCCAGCATTGGCTCGGGCAATACCGCTGGTGGCGG
C
AGCAGCAATGGGACTGTTACTCCGGCCAGCCAGCCTGGCACACCCTCCCCGCTGGATGGGCCACGGCCC
TTC
CCAACTGCCCAAGGCCGCCACAGCTCCAGTCTCTCCAATGTGCTGGAAGATGGCAGCCTGCTAGAAC
CC
AACATCAGTGGGGATGATACCTCGAACACGAGCAACCCCCAGCAAACCCCTGAAGAGGAGCTGTGCAA
C
TTACTCACCAACGTGCTATTCTCAGTGACGTGGCGGGGCGTGGAGGGCAGTGCGGAGGCCGCCTGGCGG
GAA
CGTGGCCAGGTCTTCTCCGTGCTTACCCAGCTGGGGGCCTCTGCCACACTTGTGCGACCACCAGACT
GC
ATCAAGCGCAGCCTCCTAGAGATGATGTTAGAGTCAGCCCTGACCGACATCAAGGAGGCTCCCCCAGG
A
GGCCTGGCCAACCTTTCCCAGCAGGCACTGTGGCTGCTCCGTTTACTGCAGGATTTCCTGTGTGCTGAG
GGC
CACGGTAACCAGGAGCTGTGGAGTGAGAAGCTCTTTGAAGGTGTGTGCAACCTGCTTGATCGCCTGG
GA
GCCTGGCCACATCTCGCCAATAGCACAGCAGATCTCCGGGAGATGGCGCAGATCGGCTTACGTCTTGT
G
CTTGGATACATCCTATTGGAAGACCCACAGCTGCATGCCCAGGCCTATGTGAAGCTGCACACACTGCTG
CAG
ACCGCAGTGCCGACCCGCCGGGAGGAGGCGTGCTACGTGCTCTCCAAGCTGGAGGCAGCGCTCAGTC
GG
GCGCTGACCACCTCGTCTTCCGAGACTGAGCATGCGTCTACAGCCGTGGCAGCCTCTGAGCGCTGTTC
G
TGGTTGGTGCCACTGGTCCGCACGCTGCTGGACCGTGCATATGGGCCCCTGGGACTGCAGTGGGGGCTG
CCC
TCCTTACCACCCACCAATGGAAGCCCCACCTTCTTTGAGGACTTCCAGGCTTTTTGTGCCACAGCCG
AA
TGGCGCCACTTCATCGACAAGCAGGTTCAGCCAACTATGTCAAAGTTTGAAATGGACACATATGCTAA
G
AGCCATGACCTCATGTCAGGCTTCTGGAATGCCTGCTACGACACACTCATGAGCAGCGGGCAGCGGCAT
CAG
CGGGACCGTATCCAGAGTCGGCGGGCCTTCAAGGAGCTGGTCCTAGAACCTGCCCAGCGCAGGGCTC
GC
GTGGAGGGATTGCGCTATGCATCTGTACTGAAGCAGCAGGCAGCGCAGCACTCGACGGCACTGCTCCA
C
TGGGGGGCGCTGTGGCGCCAGCTTTCTAGCCCCTGTGGGGCCTGGGCACTAAGGATCCCTCCAGCCCCC
CAC
TGGAAGCTGTCTAGTGCAGAGACATACTCCCGTATGCGACTAAAACTGGTACCCAATCATCACTTTG
AC
CCTCACCTGGAAGCTAGCGCCCTACGTGACAATCTCGGTGAAGCTCCCATGACACCCACTGAGGAGAC
C
TCACTGCCTCTGGCAGTGACCAAAGAGGCCAAAATCAGTGCCCCTCCGGAGGAGCTGCCTGAGGAGCAG
TTA
GGGGAAGAGGACCTGGCTGCACTGGAGTCCCTGATGGAGGAGGCGGCCGAGCTAGATGAGAAACGCG
AG
AAGCTTGTGTTGTCGGCTGAGTGCCAGCTCGTCACGGTGGTGGCTGTGGTCCCGGGACTCTTAGAGAT
C
ACCACACAGCACGTGTATTTCTATGACGGCAGTACGGAACGCGTGGAAACAGAGGAAGGCATCGGCCAT
GAC
TTCCGGCGCCCCTTGGCCCAGCTGCGTGAGGTCCACCTGCGGCGTTTCAACCTGCGGCGTTCGGCGC
TC
GAACTCTTCTTCATTGACCAGTCCAACTACTTCCTCAACTTCCCACACAAGGTGGCCGCGTCCTCTGC
G
TCATCCCCTTGCCAGGCTCCCAGGCCCCAGCTCTACCCTATCCCATCCCACACCCAGCTACGGAACCAG
GTG
TACTCATTGCTTCTGCGCCTAAGGCCACCCACCCAAGGCTACCTAAGCAGCCGCTCCCCACTGGAGA
TG
CTTCGTGCCTCGGGACTTACCCAGAAATGGGTACAGCGAGAGATATCCAACTTTGAGTACCTCATGCA
A
CTCAACACAATCGCAGGGCGCACCTATAATGACCTGTCTCAGTACCCTGTGTTCCCCTGGGTCTTGCAG
GAC
TATGTGTCCCCAGTCTTGGACCTCAGCAATCCAGCTGTCTTCCGGGACCTGTCCAAACCCATCGGTG
TG
GTGAATCCCAAGCATGCCCAGCTTGTGAGGGAGAAATATGAGAGCTTTGAGGACCCAGCAGGCACAAT
C
GACAAGTTCCACTATGGCACACACTATTCTAACGCAGCGGGCGTGATGCACTACCTCATCCGCGTGGAG
CCC
TTCACGTCCCTGCATGTCCAGCTACAGAGCGGCCGCTTCGACTGCTCTGACCGGCAGTTCCACTCGG
TG
GCAGCAGCCTGGCAGGCACGGCTGGAGAGCCCCGCCGACGTGAAGGAGCTCATTCCGGAGTTTTTCTA
C
TTTCCTGACTTCCTGGAGAACCAGAATGGCTTTGACCTGGGCTGCCTCCAGTTGACCAACGAGAAGGTG
GGT
GATGTGGTGCTGCCCCCGTGGGCCGGCAGCCCCGAGGATTTCATCCAGAAACACCGCCAGGCTCTGG
AG
TCAGAGTATGTGTCCACCCACCTGCACGAATGGATCGACCTCATCTTTGGCTATAAGCAGCGGGGTCC
A
GCGGCCGAGGAGGCCCTCAATGTCTTCTATTACTGCACTTACGAAGGGGCGGTTGACCTGGACCACGTG
GCA
GATGAACGGGAGCGGAAGGCTCTGGAAGGCATCATCAGCAACTTCGGGCAGACTCCTTGTCAGCTGC
TG
AAGGAGCCACACCCACCCCGGCTCTCGGCTGAGGAAGCAGCCAATCGCCTCGCCCGGCTGGACACTAA
C
TCACCAAGCATCTTCCAGAACCTCAACCAACTCAAGGCCTTTTTCGCTGAGGTTGTCAGTGAGGCTGTA
CCT
CTGGTCTTAGCTCTGGTTCCTCACCGACAGTCACACTCCTTTATCACCCAGAGCTCCTCGGACATGT
TG
GTGACTGTAAGTGCCAGTGGGCTGCTGGGCACTCATACCTGGCTGCCCTATGACCGGAACATCAATAA
C
TACTTTACCTTCAGCAAAGATCCCACCATGGGGAGCCCCAAGGTGCAGAAACTACTGAGTGGGCCCTGG
GTC
TCAGACAGTGGCGTGAGTGCACAAGCACTAGCAGTAGCTCCTGACGGAAAGCTGCTCTTCAGTGGTG
GC
CACTGGGATGGCAGCCTACGAGTGACTTCACTACCCCGTGGCAGGCTGTTGAATCAGCTAAGCCGACA
C
CTTGATATAGTGACCTGCCTTGCACTGGACACCTGCGGCATCTACCTCATCTCCGGCTCCCGGGATACC
ACG
TGCATGGTGTGGCGTCTTCTGCAGCAGAGCGGTCTGTCAGCAGGGCTGGCACCAAAGCCTGTGCAGG
TC
TTATACGGACATGTAGCTGCAGTGAGCTGTGTGGCCATCAGCACTGAACTTGACATGGCCGTGTCTGG
A
TCCGAGGATGGGACTGTGATCATACACACTGTACGTCGAGGCCAGTTTGTGGCAGCATTAAGGCCTCCA
GGT
GCCACACTGCCTGGACCTATATCGCACTTAGCACTGGGGGCTGAAGGCCAGATTGTTGTACAAAGCT
CT
GCTTGTGAACGTCCTGGGGCCCAGGTCACCTACTCCTTGCACCTGTATTCAGTGAATGGGAGGTTGCG
G
GCTTCAGTGACCCTGACGGAGCAGCCCACAGCCCTGACTGTGGCAGAAGACTTTGTTCTGCTGGGCACC
GCT
CAGTGCTCTCTACATATCCTCCACTTGAACAAATTGCGGCCCGCCGTGCCTCCCCTGCCCATGAAAG
TG
CCGGTCCACAGTGTGTCTGTGACCAAGGAGCGCAGTCATGTGCTGGTGGGCCTGGAAGATGGCAAATT
G
ATCGTTGTGGGCGCTGGGCAGCCTTCTGAGGTACGCAGCAGCCAGTTCGCGCGGAGGCTGTGGCGCTCC
TCG
CGGCGAATCTCCCAGGTGTCCTCTGGGGAGACTGAATACAATCCTGGCGAGGCTCGCTGA


Translation (2750 aa):
MAASERLYELWLLYYAQKDLGYLQQWLKAFVGVFEKTISLSSLEPRRPEEAGAEVPLLPLDALHALAEQL
D
QDDLDQALLLLKLFIILC
RNLENVEAGWGQVLVPRVLALLTVLMAELKGSSQESHGTQLENVALHALLL
C
EGLFDPYQTWRRQLT
GEVISSKEKSKYKFPPAALPCEFGAFFQENLQDAERLPPTLLLRLIHLFGAILA
G
GK
ANGQMAVSAGSVQGLLGVVRGWGRGPAQDPQQVPLALRALVGAVHVLHASRAPPRGPELRTLLEGYF
H
ILNADWPTSPSSSPEEALVTLRVSML
DAIPMMLACEDRPVLQATFLSNNCFEHLIRLIQNSKLYLQARA
P
PEGDSDLATWLLTEPDVQK
VLDQDTDAIAVHVVRVLTCIMSGSPSAKEVFKERIGYQHLQEVLQSHGPP
T
HRLLQELLNM
AVEGDHSMHPPPPIRNEQPVLVLMQWLPALPTAELRLFLAQRLWWLCDSCPASRTTCVQ
A
GLVGYLLETLNTGTALGARCQEQLLALLQALGRVSLRPLELRRLLRPPPGLDSESSGNESQKARHAGAV
I
RALSGMARHRGPARALRYFDLTPSMAGIMVPPVQRWPGAGFTFHAWLCLQSSEAVPTSAPSRPLQRKQL
Y
SFFTSSGSGFEAFFTAAGTLVVAVCTRKEYVTVNLPEVSFADSAWHCVAIVHVPGRRPFSQNLVNVFKD
G
HLVKTVPFRFPSLSE
PFSSCCIGSAGHRTTTTTTGLPASSVSTALAHTHPSLTRSQSVPASTGLGWGPG
L
GTPLQEGSVSSTLAGTQDTRWGSPTSLEGELGAVAIFHEALQPSALRVLCSL
GPNEPAPFKPEGELHEF
G
TKLLLHYSPQ
ACKNNICLDLSPGHGLDGRLTGHRVETWDVKDVVNCVGGMGVLLPLLERVAVQPQEAEA
G
PCETHDLVGPELTSGRNTQGLLLPLGKSS
EDRMERNAVAAFLLMLRNFLQNHTVNQESLVQCQGPAIIG
A
LLRK
VPSSAMDMNVLMSAQLLMEQAAADGGGPLLYLLYQHLLFNFHLWTLSDFAVRLGHIQYMSSMVRE
H
RQKLRKKYGVQFLLDALRTHY
SPQRERPLAADDLRTVQTSLLGLVREFLVRNFSVEDMQVVLNFLAATG
D
DGQ
VVGTLELLLTLLQGSPVQDPLAAFLLELGNLEVLLALLVRPKSTPLLTDRVCKILRRLQQNERLPE
R
NRQRIRLHDCGLQGLVASLSEESISPQLCQGLYKLFVGT
VPQVVSPDCLNLSDLLAVVQLSLQADLSVR
L
DICRQ
LFYLIYGQPDVVRLLARQAGWQDVLTRLYVLEAATDSSPPRFLPELPISSELALSPPPTELPAD
S
SDVFLPSESPCPDQDAFYQALSPFSTPFDLGLERASIGSGNTAGGGSSNGTVTPASQPGTPSPLDGPRP
F
PTAQGRHSSSLSNVLEDGSLLEPNISGDDTSNTSNPQ
QTPEEELCNLLTNVLFSVTWRGVEGSAEAAWR
E
RGQVFSVLTQLGASATLVRPPDCIKR
SLLEMMLESALTDIKEAPPGGLANLSQQALWLLRLLQDFLCAE
G
HGNQELWSEK
LFEGVCNLLDRLGAWPHLANSTADLREMAQIGLRLVLGYILLEDPQLHAQAYVKLHTLL
Q
TAVPTRREEACYVLSKLEAALSRALTTSSSETEHASTAVAASERCSWLVPLVRTLLDRAYGPLGLQWGL
P
SLPPTNGSPTFFEDFQAFCATAEWRHFIDKQ
VQPTMSKFEMDTYAKSHDLMSGFWNACYDTLMSSGQRH
Q
RDRIQSRRAFK
ELVLEPAQRRARVEGLRYASVLKQQAAQHSTALLHWGALWRQLSSPCGAWALRIPPAP
H
WKLSSAETYSRMRLKLVPNHHFDPHLEASALRDNL
GEAPMTPTEETSLPLAVTKEAKISAPPEELPEEQ
L
GEEDLAALES
LMEEAAELDEKREKLVLSAECQLVTVVAVVPGLLEITTQHVYFYDGSTERVETEEGIGH
D
FRRPLAQLREVHLRRFNLRRSALELFFIDQSNYFLNFPHKVAASSASSPCQAPRPQLYPIPSHTQLRNQ
V
YSLLLRLRPPTQGYLSSRSPLEMLRASGLTQ
KWVQREISNFEYLMQLNTIAGRTYNDLSQYPVFPWVLQ
D
YVSPVLDLSNPAVFRDLSKPIGVVNPKHAQLVRE
KYESFEDPAGTIDKFHYGTHYSNAAGVMHYLIRVE
P
FTSLHVQLQSG
RFDCSDRQFHSVAAAWQARLESPADVKELIPEFFYFPDFLENQNGFDLGCLQLTNEKV
G
DVVLPPWAGSPEDFIQKHRQAL
ESEYVSTHLHEWIDLIFGYKQRGPAAEEALNVFYYCTYEGAVDLDHV
A
DERERKALEGIISNFGQTPCQLLK
EPHPPRLSAEEAANRLARLDTNSPSIFQNLNQLKAFFAEVVSEAV
P
LVLALVPHRQSHSFITQSSSDML
VTVSASGLLGTHTWLPYDRNINNYFTFSKDPTMGSPKVQKLLSGPW
V
SDSGVSAQALAVAPDGKLLFSGGHWDGSLRVTSLPRGRLLNQLSRHL
DIVTCLALDTCGIYLISGSRDT
T
CMVWRLLQQ
SGLSAGLAPKPVQVLYGHVAAVSCVAISTELDMAVSGSEDGTVIIHTVRRGQFVAALRPP
G
ATLPGPISHLALGAEGQIVVQSSACERPGAQ
VTYSLHLYSVNGRLRASVTLTEQPTALTVAEDFVLLGT
A
QCSLHILHLN
KLRPAVPPLPMKVPVHSVSVTKERSHVLVGLEDGKLIVVGAGQPSEVRSSQFARRLWRS
S
RRISQVSSGETEYNPGEAR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser