NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS52886.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
52886.1 Public Mus musculus 9 Plscr1 21 106 86 CCDS HistoryNCBI Gene:22038Re-query CCDS DB by CCDS ID:52886.1Re-query CCDS DB by GeneID:22038See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 52886.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000093801 ENSMUSP00000091318 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000093801Link to Ensembl Protein Viewer:ENSMUSP00000091318Re-query CCDS DB by Nucleotide ID:ENSMUST00000093801Re-query CCDS DB by Protein ID:ENSMUSP00000091318
Original member Current member EBI,WTSI ENSMUST00000186364 ENSMUSP00000139479 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000186364Link to Ensembl Protein Viewer:ENSMUSP00000139479Re-query CCDS DB by Nucleotide ID:ENSMUST00000186364Re-query CCDS DB by Protein ID:ENSMUSP00000139479
Original member Current member EBI,WTSI OTTMUST00000055399 OTTMUSP00000026531 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000055399Link to Vega Protein Viewer:OTTMUSP00000026531Re-query CCDS DB by Nucleotide ID:OTTMUST00000055399Re-query CCDS DB by Protein ID:OTTMUSP00000026531
Original member Current member EBI,WTSI OTTMUST00000121731 OTTMUSP00000066989 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000121731Link to Vega Protein Viewer:OTTMUSP00000066989Re-query CCDS DB by Nucleotide ID:OTTMUST00000121731Re-query CCDS DB by Protein ID:OTTMUSP00000066989
Original member Current member NCBI NM_011636.2 NP_035766.2 Accepted alive Link to Nucleotide Sequence:NM_011636.2Link to Protein Sequence:NP_035766.2Re-query CCDS DB by Nucleotide ID:NM_011636Re-query CCDS DB by Protein ID:NP_035766Link to BLAST:NP_035766.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035766.2 328 Q9JJ00 328 100% 0 0

Chromosomal Locations for CCDS 52886.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 92258062 92258074 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 92259274 92259354 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 92263033 92263277 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 92264646 92264688 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 92266391 92266611 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 92266712 92266873 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 92269815 92269976 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 92271529 92271588 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (987 nt):
ATGGAAAACCACAGCAAGCAAACTGAGGCTCCCCACCCGGGAACATATATGCCAGCTGGGTATCCCCCTC
CG
TATCCACCAGCAGCTTTCCAAGGACCTTCAGACCATGCTGCTTACCCCATACCCCAGGCTGGCTACCA
A
GGGCCTCCGGGCCCCTATCCAGGGCCCCAACCTGGCTACCCAGTCCCACCAGGAGGTTATGCAGGTGGT
GGC
CCTAGTGGCTTTCCTGTCCAAAATCAGCCAGCATATAATCATCCAGGTGGGCCTGGGGGGACCCCAT
GG
ATGCCAGCCCCCCCTCCTCCACTGAACTGTCCACCGGGGCTGGAATACTTAGCTCAGATTGATCAGCT
T
CTGGTTCATCAGCAAATTGAGCTTCTGGAAGTCTTAACAGGCTTTGAAACAAATAACAAATATGAAATC
AAG
AACAGCCTCGGGCAGAGAGTTTACTTTGCAGTGGAAGATACTGACTGCTGTACCCGAAACTGCTGTG
GG
GCGTCTAGACCTTTCACCTTGAGGATCCTGGATAATCTGGGCCGAGAAGTCATGACTCTGGAGAGACC
T
CTGAGATGCAGTAGCTGCTGCTTCCCCTGCTGCCTCCAGGAGATAGAAATCCAGGCTCCTCCTGGGGTA
CCA
GTAGGTTATGTGACTCAGACCTGGCACCCATGTCTGCCCAAGTTCACTCTCCAAAATGAGAAGAAGC
AG
GATGTCCTGAAAGTAGTTGGTCCGTGTGTTGTGTGTAGCTGCTGTTCCGACATTGACTTTGAGCTCAA
A
TCTCTAGATGAAGAATCAGTAGTTGGCAAAATTTCTAAGCAGTGGTCTGGTTTTGTGAGAGAGGCCTTC
ACG
GATGCAGACAATTTTGGGATCCAGTTCCCGCTAGACCTGGATGTGAAGATGAAAGCTGTGATGCTTG
GT
GCTTGTTTCCTCATAGATTTCATGTTTTTTGAAAGAACTGGAAACGAGGAGCAAAGATCAGGAGCATG
G
CAGTAA


Translation (328 aa):
MENHSKQTEAPHPGTYMPAGYPPPYPPAAFQGPSDHAAYPIPQAGYQGPPGPYPGPQPGYPVPPGGYAGG
G
PSGFPVQNQPAYNHPGGPGGTPWMPAPPPPLNCPPGLEYLAQ
IDQLLVHQQIELLEVLTGFETNNKYEI
K
NSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNLGREVMTLERPLRCSSCCFPCCLQE
IEIQAPPGV
P
VGYVTQTWHPCLPKFTLQNEKKQDVLKVVGPCVVCSCCSDIDFE
LKSLDEESVVGKISKQWSGFVREAF
T
DADNFGIQFPLDLDVKMKAVMLGACFLI
DFMFFERTGNEEQRSGAWQ



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser