NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS52876.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
52876.1 Public Mus musculus 9 Dop1a 21 106 86 CCDS HistoryNCBI Gene:320615Re-query CCDS DB by CCDS ID:52876.1Re-query CCDS DB by GeneID:320615See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 52876.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000034987 ENSMUSP00000034987 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000034987Link to Ensembl Protein Viewer:ENSMUSP00000034987Re-query CCDS DB by Nucleotide ID:ENSMUST00000034987Re-query CCDS DB by Protein ID:ENSMUSP00000034987
Original member Current member EBI,WTSI ENSMUST00000190957 ENSMUSP00000140740 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000190957Link to Ensembl Protein Viewer:ENSMUSP00000140740Re-query CCDS DB by Nucleotide ID:ENSMUST00000190957Re-query CCDS DB by Protein ID:ENSMUSP00000140740
Original member Current member EBI,WTSI OTTMUST00000118359 OTTMUSP00000066073 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000118359Link to Vega Protein Viewer:OTTMUSP00000066073Re-query CCDS DB by Nucleotide ID:OTTMUST00000118359Re-query CCDS DB by Protein ID:OTTMUSP00000066073
Original member Current member NCBI NM_177208.3 NP_796182.2 Accepted alive Link to Nucleotide Sequence:NM_177208.3Link to Protein Sequence:NP_796182.2Re-query CCDS DB by Nucleotide ID:NM_177208Re-query CCDS DB by Protein ID:NP_796182Link to BLAST:NP_796182.2

Chromosomal Locations for CCDS 52876.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 86485466 86485603 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86487254 86487435 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86489578 86489748 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86491981 86492170 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86494396 86494494 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86500796 86500895 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86501874 86501983 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86502993 86503101 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86504177 86504297 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86506195 86506314 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86506405 86506519 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86506871 86506900 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86507504 86507737 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86512561 86513179 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86513825 86514099 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86515258 86515410 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86516967 86517064 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86518154 86518413 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86519873 86521859 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86522763 86522874 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86522954 86523136 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86524224 86524349 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86526772 86526906 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86531715 86531770 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86532930 86533034 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86535908 86535974 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86536115 86536259 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86536443 86536522 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86542359 86542468 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86542735 86542884 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86543009 86543070 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86545241 86545393 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86548170 86548306 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86548801 86548856 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86550003 86550167 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86551646 86551775 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 86554016 86554321 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (7389 nt):
ATGAACACAGAAGAGCTAGAGTTATTGAGTGACTCCAAATACAGAAACTATGTAGCTGCCATTGACAAAG
CA
CTAAAGAATTTTGAATACTCCAGTGAATGGGCAGACTTGATCTCAGCACTTGGAAAACTCAACAAGGT
T
TTACAAAATAATGCCAAGTACCAGGTAGTACCCAAAAAACTGACCATAGGCAAACGCCTAGCTCAATGT
CTG
CACCCAGCATTACCAGGTGGGGTTCATCGGAAAGCACTTGAAACCTATGAAATCATCTTCAAAATCA
TT
GGCCCTAAGCGACTTGCCAAAGATCTCTTTTTATATAGTTCTGGGTTGTTTCCTCTTCTTGCCAATGC
T
GCTATGTCTGTGAAGCCAGCACTGCTCGGTTTGTATGAGATGTACTACTTGCCCTTGGGGAAAACCCTG
AAA
CCTGGTCTCCAGGGGTTGCTGACTGGTATCCTTCCTGGCTTAGAAGAAGGGTCGGAGTATTATGAGA
G
A
ACAAACACCCTGCTGGAAAAGGTTGCTGCGGCTGTAGAGCAGTCTGCATTCTACAGTGCCCTATGGGG
C
AGTCTGCTCACCAGTCCTGCTGTGCGCTTACCTGGAATCACATATGTTCTGGCCCATCTGAACAGGAAA
CTT
TCAATGGAAGATCAGCTGTATATAATTGGCAGCGACATTGAGCTCATGGTAGAAGCAGTAAGCACTT
CA
GTGCAGGACTCGAGTGTACTTGTACAGAGAAGCACGCTGGACCTCATCCTCTTCTGTTTCCCATTCCA
T
ATGAGTCAGGCCACTCGACCAGATATGATCAGGATCTTGTCAGCAGCCCTTCATGTAGTACTAAGGAGG
GAT
ATGTCCTTGAACCGAAGACTTTATGCATGGCTTCTTGGTTTTGATAACAACGGTGCTATCATAGGAC
CA
AGGAGCACACGACACAGTAATCCTGAAGAACACGCCACTTACTATTTTACAACCTTTTCAAAAGAATT
G
TTAGTCCAGGCCATGGTGGGGATCTTACAAGTGAATGGATTTGGAGAAGAAAGCACTCTCATGCAGGAT
CTA
AAACCTTTTCGTATTTTAATCAGTTTATTGGACAAACCTGAACTAGGACCTGTAATCCTAGAAGATG
TT
CTGATTGAGGTGTTTAGAACTTTGTATTCTCAGTGCAAAGCAGAATTGGATCTTCAGATGGAACCACC
C
TTCAGCAAGGACCATGCTCAATTAAGCAGTAAATTAAGGGAAAATAAGAAAACAGCCGAACTGATTAAA
ACT
GCAAATCTGCTTTTTAATTCCTTCGAACCTTATTATATGTGGGATTACATTGCACGCTGGTTTGAAG
AA
TGTTGTCGGAGAACTCTGCACGCCAGACTTCAGGTTGGACCTGGAGACAGTAGTGATTCGTCTGAGTT
A
CAACTGACTAATTTCTGCTTACTGGTGGATTTTTTGTTGGATATAGTCTCCTTGCCTACTAGAAGTATG
AGG
GTGCTGTGTCAGGAGACCTATATTGAAATCCAGACAGAACACCTGCCCCAGTTACTGCTTAGAATGA
TT
TCTGCCTTGACAAGCCATCTCCAGACATTGCGCTTATCTGAGCTCACAGACTCTTTAAGGCTCTGCTC
G
AAGATCCTTAGCAAGGTTCAGCCCCCATTGTTATCTGCTGGCAATGGAGGTGTGGTACAGTTTCCAAGT
GGG
CAGAACAGTACAGTCAAAGAATGGGAAGACAAAAAGGTATCATCAGTTTCTATGGAAAATCCTGCTG
AA
GTATTTGAAGATGGAGAAAATCCACCAAGTAGTCGATCATCAGAAAGTGGGTTCACTGAGTTTATCCA
G
TATCAAGCAGACCGGCCTGACGACCTCGACAGAGAGCTGAATGGACAGGGGGCAGCTACCATCCCAATT
GGC
AGCACATCTTCGGAAACAGAAACAGCATCCACAGTGGGTTCTGAGGAAACCGTCATCCAGCCACCTT
CC
ACCTTCACTCAGGGGGCAGCAGGCCGAAGCGGGAAGGCGGTACAGAAGACTGCAATGCAGTGCTGCTT
G
GAGTATGTCCAGCAGTTTCTTTCCAGGCTCATCAACCTCTACATCATCCACAGTGACTCCTTTCCTCAA
GCT
TTGGCTGCAGATCATCAGGGAGACTTCAGTCGAATACAAAGGGAGACTTCAAAATGGGACAGGGATT
CC
CAAGGGGATGCAAAAGAAAGAAACATACATACTCCAAAAACATCAAAAGAATACCTTTCTGCCTTCCT
T
GCTGCCTGTCAGCTCTTCTTAGAGTGCTCAAGTTTCCCAGTCTACATCGCTGAGGGAAACCATACATCA
GAG
TCACATTCTGAGAAACCGGACACTGACTGTGAGCACGCCCACCCTCCACAGTGGCTCCGGACGCTGA
TG
AGCGCTTGCAGCCAAGCACGTGATTTCAGGGTTCAGAGTGCTGCTGTGTCTCTAGTCATGGACCTGGT
G
GGACTGACTCAATCTGTTGCCATGGTCACTGGAGAAAACATCAACAGCATGGAGCCTGCACAACCCTTG
AGT
CCAAACCAAGGAAGAGTGGCTGTGGTTATTAGACCTCCCCTCACACAGGGCAACCTGAAGTATATAG
CT
GAGAAGACTGAATTTTTCAAGCATGTGGCCTTAACATTATGGGACCAGCTGGGAGATGGGACACCTCA
G
CACCATCAGAAGAGTGTGGAACTATTTTATCAATTACATAATTTGGTTCCTTCTTCTAGCATCTGTGAG
GAC
GTTGTAAGTCAGCAGTTAACCCATAAAGACAAGAAAATAAGGATGGAAGCACATGCAAAATTTGCAG
TT
CTTTGGCATCTAACAAGGGATCTCCACATAAATAAGTCATCTTTTGCACGTTCCTTTGACAGGTCACT
G
TTCATCATGCTAGATAGCCTTACTAGTTTAGATGGTTCTACGAGCTCTGTGGGACAAGCCTGGCTGAAC
CAG
GTGCTACAAAGGCATGACATTGCAAGGGTGCTGGAACCACTGTTACTGCTCCTGCTTCATCCAAAAA
CT
CAGAGGGTTTCAGTGCAGCGGGTACAAGCAGAACGGTACTGGAGTAAGACGTCCTGTTATCCAGGAGA
G
GAAAATGATAAGCATTTCATGCAAAATTTTACCTGCAACAATGTAAGCCAAGTGCACCTCATTGCATCC
AAA
GGAAATGGTGAAAAGCCCCTTACCATGGATGAAATGGAGAATTTCAGTCTTACTGTTAATCCATTGA
GT
GATAGACTTTCCCTCCTAAGCACCAGCAGCGAGACGATTCCAATGGTTGTATCTGACTTTGACCTCCC
A
GATCAGCAGATGGAAATACTTCAGAGCTCTGACTCTGGATGCTCACAGTCTTCTGCTGGAGACAACTTT
AGT
TACGAAGTTGATCCTGAAAATGCGAATGCCCATGAAGATTCTCACATGGCAAAGGCAAGCTCCCCAG
AT
GATGATGTTCAGCAAGTTGTCTTTGACCTGATATGTAAAGTTGTGAGTGGCCTGGAAGCAGAGTCTGA
A
TCAGTTACATCTGAATTAGAAATCGAATCTCTGCAAACAAAGAGTAGTGACTTAGATCCAGGTAAAGAA
GCA
ACTAAGATTGAAGACCAGGCCCCTCAACACAGCCAGCATGTTTTGCTGAGCGATGACAGCCCTCGGT
TT
CTGTCTGTGTCTACAGAGGAAGGCTGTGAGTGCTTGGCCAATGGAATCTCCAGAAATAGCTCCTCACC
T
TGCATTTCAGGAACAGCACAGACTCTGAACGATTCTTCTGTTCCCTCAGAAACCAAATCTAGACAGAGG
AGT
CACAGTAGTATTCAATTTAGCTTCAAAGAAAAATTATCAGAAAAAGTCTCAGAGAAAGAAACAATTG
TT
AAGGAATCAGGTAAACAACCAGGTGCAAAACCCAAAGTAAAGCTGGCCAGGAAAAAAGATGAGGACAA
G
AAAAAAGCTGCAAGTGAGAAACTGAAGCAAGCAAATGTCTTCTTCAGTGAGGGCCTGGACTTAGAGAAC
TGG
TACAGCTGTGGGGAGGGCGAAATTTCTGAAATTGAGAGTGACATGGGTTCTCCAGGATCTAGGAAAT
CT
CCCAACTTCAACATCCATCCTCTCTATCAACACGTGCTCCTGTATCTGCAGCTGTATGATTCATCGAG
G
ACTCTGTATGCTTTTTCTGCCATCAAATCCATCTTGAAAACTAACCCCATTGCTTTTGTAAACGCCATT
TCA
ACAACAAGTGTAAACAATGCATACACCCCTCAGCTGTCTCTGCTTCAGAACCTGCTGGCTAGACACC
GA
ATCTCTGTTATGGGCAAAGACTTTTACAGTCACATTCCAGTGGATTCAAACCATAACTTCCGGAGTTC
C
ATGTACATTGAAATTCTTATTTCCCTCTGCTTATATTATATGCGTAGCCATTACCCAACTCATGTCAAG
GTC
ACTACCCAAGACTTAATAGGCAATCGAAACATGCAAATGATGAGCATAGAAATCTTGACTCTCCTCT
TT
ACAGAGCTAGCAAAAGTAATAGAGAGCTCTGCAAAGGGTTTCCCTAGTTTTATCTCTGATATGCTGTC
T
AAGTGCAAAGTTCAGAAAGTGATTCTTCATTGTTTGCTGTCGTCTATCTTCAGCGTACAAAAGTGGCAC
AGT
GAGAAAACAGCAGGTAAGAGCATGGTTGCTGTGGAGGAGGGCTTCTCAGAAGACAGCCTCATCAATT
TC
TCAGAGGATGAACTTGACAATGGCAGCACACTGCAGTCGCAGCTTCTGAGGGTGCTTCAGAGGCTGAT
T
GTTCTAGAGCACCACGTGATGACTATTCCTGAGGAGAATGAAGCAGGCTTTGATTTTGTTGTGTCTGAT
CTG
GAACATATCAGTCCCCATCAGCCCATGACTTCTCTTCAGTATTTACATGCTCAGCCAATCACATGTC
AA
GGCATGTTCCTCTGTGCAGTGATTAGAGCTTTGCATCAGCACTGTGCATGTAAGATGCATCCACAATG
G
ATTGGCTTAATCACTTCCACTCTGCCTTACATGGGAAAAGTTCTACAAAGAGTCGTGGTTTCTGTGACA
CTA
CAGCTGTGCAGGAATTTGGATAATCTAATTCAGCAGTACAAATACGAAACAGGATTATCTGATAGTA
G
G
CCTTTGTGGGTGGCATCAATTATCCCACCAGATATGATTCTTACTCTTTTGGAAGGAATCACAGCCAT
T
ATCCATTACTGCTTGCTGGATCCGACTACCCAGTATCATCAACTTTTGGTCAATGTAGATCAGAAACAC
TTG
GTTGAAGCTCGCAGTGGAATCCTCTCAATCCTTCACATGATCATGTCCTCTGTAACTCTGCTTTGGA
GC
ATACTGCACCAGGCTGATGCTTCAGAAAAGATGGCAGTTGCTGCATCCGCGTCTGTTACTACAATCAA
T
CTGGGAGCCACAAAGAACTTGAGACAACAAATCCTGGAATTACTGGGACCCATTTCAATGAATCATGGT
GTT
CATTTCATGGCTGCCATTGCATTTGTATGGAATGAAAGAAGACAGAACAAAACCCCTTCCAGAACAA
AG
GTCATCCCTGCAGCCAGTGAAGAACAGCTTTTACTAGTAGAACTGGTTCGCTCCATCAGTGTCATGAG
G
GCAGAAACTGTTATCCAGACTGTGAAAGAAGTTTTAAAGCAGCCTCCAGCCATAGCCAAGGACAAGAAA
CAT
CTTTCTCTGGAAGTCTGCATGCTTCAGTTTTTCTACGCTTATATACAAAGAATTCCAGTGCCCAATA
TA
GTGGACAGTTGGACATCATTATTGGTCCTTCTAAAAGATTCTATACAGCTGAGTCTGCCAGCCCCAGG
G
CAGTTTCTTATACTTGGGGTTTTGAATGAGTTTATTATGAAAAACCCTAGTTTGGAAAATAAAAAGGAC
CAA
AGAGACCTTCAGGATGTGACTCACAAAATAGTGGATGCTATTGGTGCAATTGCTGGTTCCTCTCTGG
AA
CAGACAACATGGCTCCGACGGAATCTGGAAGTTAAGCCTTCTCCCAAAATAATGGTGGATGGAACCAA
T
TTAGAGTCTGATGTTGAAGATATGTTATCCCCTGCAATGGAAACCTCAAACATAACTCCTTCTGTATAT
AGT
GTCCATGCACTGACGTTGCTCTCAGAGGTATTGGCTCATCTTCTGGATATGGTTTTCTACAGCGATG
AA
AAAGAGCGTGTTATCCCTTTACTTGTAAACATTATGCATTATGTTGTACCCTACCTCCGAAATCACAG
T
GCACATAATGCCCCTAGTTACCGAGCCTGTGTCCAGCTGCTCAGTAGTCTTAGTGGGTATCAGTATACA
AGG
AGAGCCTGGAAAAAAGAAGCCTTTGACCTTTTTATGGATCCCAGCTTCTTTCAGATGGATGCTTCCT
GT
GTTAGTCACTGGAGAGCAATCATGGACAACCTGATGACACATGATAAGACAACCTTCAGAGATTTGAT
G
ACTCGAGTAGCCGTGGCCCAGAGCAGTTCTCTCAATCTTTTTGCAAACCGGGATGTGGAGCTAGAACAG
CGA
GCCATGCTTCTCAAAAGACTGGCCTTCGCCGTTCTTAGCAGTGAAAGTGACCAGTACCAAAAGTACC
TT
CCAGACATACAAGAGAGATTGGTTGAGAGTCTCCGTTTGCCCCAGGTGCCGACCCTTCACTCTCAAGT
G
TTCCTGTTTTTCAGAGTGTTACTTTTAAGAATGTCTCCACAACACCTCACCTCACTCTGGCCTACCATG
ATC
ACAGAACTTGTGCAGGTGTTCTTACTGATGGAGCAGGAGCTCACTGCTGATGAAGATATTTCACGGA
CG
TCAGGGCCGTCTGCTGCTGGTCTGGAGACAACCTATACTGGAGGTAATGGCTTCTCCACATCATATAA
C
AGCCAGAGGTGGTTAAACCTCTATCTCTCTGCTTGCAAGTTTTTGGATTTGGCTCTGGCATTGCCCTCT
GAA
AATCTTCCTCAGTTTCAGATGTACCGATGGGCCTTTATTCCTGAAGCTTCAGATGACTCGGGCTTAG
AA
GTCAGAAGGCAGGGCATACATCAGCGAGAATTTAAGCCATATGTGGTTCGACTAGCAAAACTTCTTCG
G
AAGAGGGCAAAGAAAAACCCAGAGGAAGACTGCTCGGGGAGGACACTGGGCTGGGAGCCAGGGCACTTG
CTG
CTGACGCTCTGCACCATGCGCAACATGGAGCAGCTTCTGCCTTTCTTCAATGTCCTCAGCCAAGTCT
TC
AACAGCAAAGTCACAAGCCGCTGTGGCGGACACTCAGGGAGCCCCGTCCTCTACCCAAACTCCTTCCC
A
AACAAGGACATGAAACTGGAGAATCACAAAGCCTTTTCCAGCAAAGCCAGGCAAAAAATTGAAGAGATG
ATA
GAAAAGGACTTTCTAGAAGGAGTCATAAAGACTTGA


Translation (2462 aa):
MNTEELELLSDSKYRNYVAAIDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPKKLTIGKRLAQC
L
HPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLY
SSGLFPLLANAAMSVKPALLGLYEMYYLPLGKTL
K
PGLQGLLTGILPGLEEGSEYYE
RTNTLLEKVAAAVEQSAFYSALWGSLLTSPAVRLPGITYVLAHLNRK
L
SMEDQLYIIGSDIELM
VEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALHVVLRR
D
MSLNRRLYAWLL
GFDNNGAIIGPRSTRHSNPEEHATYYFTTFSKELLVQAMVGILQVNGFGEESTLMQD
L
KPFRILISLLDKPEL
GPVILEDVLIEVFRTLYSQCKAELDLQMEPPFSKDHAQLSSKLRENKKTAELIK
T
ANLLFNSFEPYYMWDYIARWFEECC
RRTLHARLQVGPGDSSDSSELQLTNFCLLVDFLLDIVSLPTRSM
R
VLCQ
ETYIEIQTEHLPQLLLRMISALTSHLQTLRLSELTDSLRLCSKILSKVQPPLLSAGNGGVVQFPS
G
QNSTVKEWEDKK
VSSVSMENPAEVFEDGENPPSSRSSESGFTEFIQYQADRPDDLDRELNGQGAATIPI
G
STSSETETASTVGSEETVIQPPSTFTQGAAGRSGKAVQKTAMQCCLEYVQQFLSRLINLYIIHSDSFPQ
A
LAADHQGDFSRIQRETSKWDRDSQGDAKERNIHTPKTSKEYLSAFLAACQLFLECSSFPVYIAEGNHTS
E
SHSEKPDT
DCEHAHPPQWLRTLMSACSQARDFRVQSAAVSLVMDLVGLTQSVAMVTGENINSMEPAQPL
S
PNQGRVAVVIRPPLTQGNLKYIAEKTEFFK
HVALTLWDQLGDGTPQHHQKSVELFYQLHNLVPSSSICE
D
VVSQQLTHKDK
KIRMEAHAKFAVLWHLTRDLHINKSSFARSFDRSLFIMLDSLTSLDGSTSSVGQAWLN
Q
VLQRHDIARVLEPLLLLLLHPKTQRVSVQRVQAERYWSKTSCYPGEENDKHFMQNFTCNN
VSQVHLIAS
K
GNGEKPLTMDEMENFSLTVNPLSDRLSLLSTSSETIPMVVSDFDLPDQQMEILQSSDSGCSQSSAGDNF
S
YEVDPENANAHEDSHMAKASSPDDDVQQVVFDLICKVVSGLEAESESVTSELEIESLQTKSSDLDPGKE
A
TKIEDQAPQHSQHVLLSDDSPRFLSVSTEEGCECLANGISRNSSSPCISGTAQTLNDSSVPSETKSRQR
S
HSSIQFSFKEKLSEKVSEKETIVKESGKQPGAKPKVKLARKKDEDKKKAASEKLKQANVFFSEGLDLEN
W
YSCGEGEISEIESDMGSPGSRKSPNFNIHPLYQHVLLYLQLYDSSRTLYAFSAIKSILKTNPIAFVNAI
S
TTSVNNAYTPQLSLLQNLLARHRISVMGKDFYSHIPVDSNHNFRSSMYIEILISLCLYYMRSHYPTHVK
V
TTQDLIGNRNMQMMSIEILTLLFTELAKVIESSAKGFPSFISDMLSKCKVQKVILHCLLSSIFSVQKWH
S
EKTAGKSMVAVEEGFSEDSLINFSEDELDNGSTLQSQLLRVLQRLIVLEHHVMTIPEENEAGFDFVVSD
L
EHISPHQPMTSLQYLHAQPITCQGMFLCAVIRALHQHCACKMHPQWIGLITSTLPYMGKVLQRVVVSVT
L
QLCRNLDNLIQQYKYETGLSDS
RPLWVASIIPPDMILTLLEGITAIIHYCLLDPTTQYHQLLVNVDQKH
L
VEARSGILSILHMIMSSVTLLWSILHQADASEKMAVAASASVTTINLGATK
NLRQQILELLGPISMNHG
V
HFMAAIAFVWNERRQNKTPSRTK
VIPAASEEQLLLVELVRSISVMRAETVIQTVKEVLKQPPAIAKDKK
H
LSLEVCMLQFFYAYIQ
RIPVPNIVDSWTSLLVLLKDSIQLSLPAPGQFLILGVLNEFIMKNPSLENKKD
Q
RDLQ
DVTHKIVDAIGAIAGSSLEQTTWLRRNLEVKPSPKIMVDGTNLESDVEDMLSPAMETSNITPSVY
S
VHALTLLSE
VLAHLLDMVFYSDEKERVIPLLVNIMHYVVPYLRNHSAHNAPSYRACVQLLSSLSGYQYT
R
RAWKKEAFDLFMDPSFFQMDASCVS
HWRAIMDNLMTHDKTTFRDLMTRVAVAQSSSLNLFANRDVELEQ
R
AMLLKRLAFAVLSSESDQYQKYLPDIQ
ERLVESLRLPQVPTLHSQVFLFFRVLLLRMSPQHLTSLWPTM
I
TEL
VQVFLLMEQELTADEDISRTSGPSAAGLETTYTGGNGFSTSYNSQRWLNLYLSACKFLDLALALPS
E
NLPQFQ
MYRWAFIPEASDDSGLEVRRQGIHQREFKPYVVRLAKLLRKRAKKNPEEDCSGRTLGWEPGHL
L
LTLCTMRNMEQLLPFFNVLSQVFNSKVTSRCGGHSGSPVLYPNSFPNKDMKLENHKAFSSKARQKIEEM
I
EKDFLEGVIKT




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser