NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS52840.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
52840.1 Public Mus musculus 9 Herc1 21 106 86 CCDS HistoryNCBI Gene:235439Re-query CCDS DB by CCDS ID:52840.1Re-query CCDS DB by GeneID:235439See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 52840.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000042824 ENSMUSP00000044801 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000042824Link to Ensembl Protein Viewer:ENSMUSP00000044801Re-query CCDS DB by Nucleotide ID:ENSMUST00000042824Re-query CCDS DB by Protein ID:ENSMUSP00000044801
Original member Current member EBI,WTSI OTTMUST00000042050 OTTMUSP00000018912 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000042050Link to Vega Protein Viewer:OTTMUSP00000018912Re-query CCDS DB by Nucleotide ID:OTTMUST00000042050Re-query CCDS DB by Protein ID:OTTMUSP00000018912
Original member Current member NCBI NM_145617.3 NP_663592.3 Accepted alive Link to Nucleotide Sequence:NM_145617.3Link to Protein Sequence:NP_663592.3Re-query CCDS DB by Nucleotide ID:NM_145617Re-query CCDS DB by Protein ID:NP_663592Link to BLAST:NP_663592.3

Chromosomal Locations for CCDS 52840.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 66371812 66372741 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66376317 66376412 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66384993 66385187 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66386599 66386910 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66388161 66388257 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66388755 66388898 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66391360 66391487 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66394660 66394804 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66394928 66395099 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66396636 66396770 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66397253 66397418 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66397838 66397963 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66399258 66399479 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66399768 66399920 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66400047 66400179 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66402524 66402715 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66407984 66408205 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66411016 66411189 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66414075 66414189 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66414279 66414399 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66416184 66416355 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66418396 66418708 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66419129 66419249 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66420997 66421048 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66428811 66429079 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66433276 66433491 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66433724 66433844 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66434066 66434303 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66434411 66434598 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66437595 66437750 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66439178 66439284 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66439796 66439906 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66441903 66442079 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66445453 66445692 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66446085 66446168 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66448012 66448532 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66450703 66451478 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66453337 66453535 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66455936 66456096 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66457437 66457553 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66458194 66458425 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66460408 66460532 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66461700 66461920 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66462829 66463097 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66464706 66464758 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66465381 66465581 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66466499 66466673 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66467383 66467653 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66467760 66467973 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66468978 66469183 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66470238 66470365 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66471846 66471973 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66473383 66473583 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66474734 66474864 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66475921 66476120 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66476328 66476433 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66478945 66479091 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66479431 66479532 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66480862 66481035 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66481804 66482097 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66483657 66483722 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66483878 66484003 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66484899 66485037 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66486067 66486248 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66486924 66487079 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66487949 66488071 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66489330 66489432 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66491958 66492127 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66493156 66493294 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66495900 66496069 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66497169 66497338 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66497589 66497754 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66498680 66498756 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66501176 66501428 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66501930 66502082 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66504588 66504893 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 66508139 66508324 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (14580 nt):
ATGGCGACTATGGTTCCACCAGTGAAACTGAAATGGCTTGAACATCTGAATAGCTCCTGGATCACAGAGG
AC
AGTGAATCTATTGCTACAAGAGAGGGAGTTACCGTTTTGTATTCTAAACTGATCAGCAATAAGGAAGT
A
GTACCTTTGCCTCAACAGGTTTTATGCCTCAAAGGACCACAGTTGCCTGATTTTGAACGTGAGTCTCTT
TCA
AGTGATGAGCAGGACCATTATTTGGATGCCCTTCTTAGCAGCCAGCTAGCACTAGCAAAGATGGTAT
GT
TCAGATTCTCCATTTGCTGGGGCGCTAAGAAAACGACTGCTTGTACTCCAACGTGTCTTTTATGCACT
T
TCTAATAAGTACCATGACAAAGGCAAAGTGAAACAGCAGCAGCATTCTCCGGAGAGCAGCTCTGGTTCA
GCA
GATGTCCATTCTGTCAGTGAACGCCCCCGGTCAAGCACTGATGCACTTATAGAAATGGGTGTCCGAA
CT
GGTCTAAGTTTGTTATTTGCACTTCTGAGACAGAGTTGGATGATGCCTGTGTCGGGACCTGGCCTCAG
T
CTCTGCAACGACGTTATTCATACTGCAATTGAAGTTGTGAGCTCTTTGCCTCCATTGTCTTTAGCAAAT
GAA
AGCAAGATTCCTCCTATGGGCTTGGACTGCTTATCACAAGTCACAACATTTCTTAAAGGAGTAACTA
TT
CCCAATTCTGGGGCAGACACTTTAGGTCGTCGATTAGCTTCTGAGTTGCTGCTTGGCTTAGCAGCTCA
G
AGAGGCTCTTTGAGATACCTTCTTGAATGGATAGAAATGGCTTTGGGGGCTTCAGCAGTTGTATATACT
ATG
GAGAAAAACAAACTACTGTCAAGCCAGGAAGGAATGATCAGCTTTGACTGCTTTATGGCTATATTAA
TG
CAGATGAGGCGATCTTTGGGTTCATCTGCTGATCGGAGTCAGTGGAGAGAACCAACTAGAACATCTGA
A
GGCTTATGTTCACTCTATGAGGCAGCATTATGTCTTTTTGAAGAGGTTTGCAGAATGGCTTCTGACTAT
TCA
AGAACATGTGCTAGCCCAGATAGCATTCAGACTGGTGATGCTCCCATTGTTTCTGAAACCTGTGAGG
TA
TATGTTTGGGGCAGCAACAGCAGCCATCAGTTGGTAGAAGGCACACAGGAGAAAATACTACAACCCAA
A
CTGGCTCCTAGTTTCTCTGATGCTCAGACCATTGAAGCTGGACAGTATTGCACTTTTGTCATTTCTACA
GAT
GGCTCTGTCAGAGCTTGTGGTAAAGGCAGCTATGGGAGACTGGGCCTCGGAGATTCCAATAATCAGT
CT
ACCTTAAAAAAGTTAACTTTTGAGCCTCACCGGTCTATTAAGAAAGTTTCATCATCTAAAGGCTCTGA
T
GGTCACACTTTAGCTTTTACTACAGAAGGTGAAGTCTTCAGCTGGGGAGATGGTGACTATGGGAAACTA
GGA
CATGGGAATAGTTCAACCCAGAAATACCCCAAGCTTATCCAGGGCCCACTACAGGGAAAGGTAGTAG
TT
TGTGTATCAGCTGGATACAGACATAGTGCTGCTGTCACAGAGGATGGTGAATTATATACTTGGGGTGA
A
GGAGACTTCGGAAGATTAGGTCATGGTGACAGTAACAGCCGTAACATTCCAACATTAGTAAAAGACATT
AGC
AATGTAGGAGAGGTTTCTTGTGGAAGTTCACATACGATTGCTTTGTCCAAAGATGGAAGAACTGTGT
GG
TCTTTTGGAGGAGGTGACAATGGCAAACTTGGCCATGGTGATACCAACAGAGTATATAAACCTAAAGT
T
ATTGAAGCTTTACAAGGAATGTTTATTCGCAAAGTCTGTGCTGGGAGCCAATCTTCACTTGCTTTGACA
TCA
ACAGGGCAGGTTTATGCTTGGGGCTGTGGGGCTTGTCTAGGTTGTGGTTCTTCAGAAGCTACTGCTT
TG
AGACCCAAGCTCATTGAAGAATTGGCTGCCACAAGAATAGTTGATATTTCAATTGGAGATAGTCATTG
T
TTGTCTCTTTCTCATGATAATGAAGTTTATGCCTGGGGCAATAACTCCATGGGACAATGTGGCCAGGGA
AAT
TCAACAGGTCCTATTACTAAACCAAAGAAAGTGAGTGGCTTAGATGGCATAGCTATTCAGCAGATCT
CA
GCTGGAACATCACATAGTTTGGCATGGACTGCTCTCCCTAGGGACAGACAAGTTGTTGCATGGCACAG
G
CCTTATTGTGTAGATCTTGAAGAGAGTACCTTCTCACATCTGCGATCTTTTCTTGAGAGATACTGTGAT
AAA
ATAAACAGTGAGATTCCCCCACTGCCTTTCCCTTCATCAAGGGAACACCATAATTTTCTTAAGCTGT
GC
CTGAAGTTGCTTTCAAATCACCTTGCTCTGGCCCTGGCGGGAGGGGTAGCTACCAGTATTCTTGGGAG
A
CAGGCAGGTCCACTTCGAAATTTGCTCTTCAGGCTGATGGATTCAACTGTCCCAGATGAAATCCAAGAG
GTG
GTAATTGAAACACTCTCAGTTGGAGCAACCATGCTGTTACCTCCATTAAGAGAACGGATGGAATTAC
TT
CATTCTCTTTTACCCCAAGGACCTGATAGATGGGAAAGCTTATCCAAAGGACAGAGAATGCAACTGGA
T
ATAATTCTGACAAGTTTACAAGATCATACCCATGTAGCCTCCCTTCTTGGCTATAGCTCACCTTCCGAT
GCT
GCTGACCTTTCGACTGTGTGCATGGGATATGGAAACCTGTCAGACCAACCATATGGTTCTCAGATCT
GC
CATCCAGACACTCATCTGGCCGAAATTTTAATGAAGACTCTCTTAAGAAATTTAGGGTTTTATACGGA
T
CAAGCATTTGGAGAGCTGGAAAAGAATAGTGATAAATATCTTCTTGGAACATCATCTTCAGAGAACAGT
CAG
CCTGCTCATCTTCATGAACTACTGTGTTCATTACAGAAACAACTGCTTGCTTTTTGCCACATTAATA
AT
GTTACTGAGAACTCAAGCAGTGTGGCATTGCTTCATAAACATCTTCAGCTTTTGCTGCCTCATGCCAC
A
GATATTTATTCACGTTCCGCAAATTTGCTTAAAGAAAGTCCTTGGAATGGCAGTGTTGGAGAAAAATTG
AGA
GATGTGATCTATGTGTCAGCTGCAGGCAGTATGCTCTGCCAGATTGTTAACTCCCTACTGTTACTCC
CG
GTGTCAGTGGCTCGTCCTTTATTGAGTTACCTCCTCGACCTCTTGCCACCTCTTGATTGCCTTAATAG
A
CTCCTGCCAGCTGCTGCTCTTTTAGAAGACCAAGAATTACAGTGGCCTCTTCATGGGGGGCCAGAAGTA
ATT
GACCCAGCTGGTGTGCCATTACCTCAACCAGCTCAATCTTGGGTATGGCTTGTGGATCTGGAAAGAA
CA
ATTGCTCTCCTCATTGGCCGATGTCTTGGTGGCATGCTTCAAGGCTCCCCCGTGTCTCCAGAGGAACA
G
GATACTGCATATTGGATGAAAACACCACTTTTCAGTGATGGTGTGGAAATGGACACCCCTCAGTTGGAT
AAA
TGCATGAGCTGCCTACTAGAAGTAGCTCTTTCAGGAAATGAAGAACAGAAGCCTTTTGATTACAAAT
TG
CGGCCTGAAGTTGCTGTCTATGTAGACTTGGCATTGGGTTGTTCTAAAGAGCCTGCCAGAAGCCTTTG
G
ATCAGCATGCAGGATTATGCTGTCAGTAAAGATTGGGACAGTGCAACTTTAAGCAATGAGTCACTCTTG
GAC
ACTGTGTCTAGATTTGTTCTTGCAGCACTCCTCAAACACACAAACTTACTTAGTCAAGCATGTGGAG
AA
AGCCGATACCAACCTGGTAAAAGCTTATCAGAAGTGTATCGTTGTGTATACAAAGTTCGAAGTCGTTT
A
CTTGCTTGCAAGAACCTTGAACTTATTCAAACCAGGTCATCATCACGAGACAGATGGATCACAGATAAC
CAA
GACTCTGCAGATGTTGATCCTCAAGAACATTCCTTTACCCGGACCATTGATGAAGAAGCTGAAATGG
AA
GAGCTGGCTGAGAGAGACAGGGAGGATGGCCACCCAGAGCCAGAAGATGAGGAAGAAGAGCGGGAACA
T
GAAGTAATGACAGCTGGCAAAATCTTTCAGTGTTTCCTCTCAGCCCGAGAAGTAGCTCGTAGCCGAGAC
CGA
GATAGAATGAACAGTGGGGCAGGGTCTGGGGTCCGAGCTGATGACCCACCTCCACAGTCTCAGCAGG
AA
CGACGGGTCAGCACAGACCTTCCTGAGGGGCAGGATGTGTACACTGCTGCCTGCAACTCTGTGATCCA
C
CGCTGTGCGCTCCTAATATTAGGAGTAAGTCCTGTGATTGATGAGCTTCAGAAGCGAAGGGAAGAAGGG
CAG
TTACAGCAGCCTTCTGTGAGTGCCTCTGAAGGCACCGGACTTATGACCAGGAGTGAAAGTCTCACTG
CT
GAGAGCCGCCTAGTTCATGCAAGTCCAAGTTACAGACTGATCAAATCAAGGAGTGAATCTGATCTGTC
T
CAGCCTGAATCAGATGAAGAGGGTTATGCACTGAGTGGCCGACGAAATGTTGACTTTGATTTGGCATCA
TCT
CATAGGAAGAGAGGTCCTATGCATAGTCAATTAGAATCTCTGAGTGACTCTTGGACTCGCCTGAAAC
AT
ACCAGAGATTGGTTCTACAACTCCTCTTACTCCTTTGAGTCTGATTTTGACCTTACCAAGTCTTTGGG
A
GTTCACACATTGATTGAAAATGTTGTAAGTTTTGTGAGTGGAGATGTGGGGAATGCTCCAGGTTTCAAG
GAG
CCGGAAGAAAGTATGTCTACAAGTCCCCAGGCCTCCATCATTGCAATGGAGCAGCAACAGCTAAGGG
CA
GAGCTTCGTTTGGAGGCACTTCACCAGATCCTCACTCTATTGTCTGGCATGGAAGAAAAGGGTAACGT
C
TTGCTGACAGGAAGCAGATCAAGTTCAGGCTTTCAGTCATCCACCCTGCTCACATCTGTGAGATTGCAG
TTT
CTAGCAGGGTGTTTCGGTTTAGGTACTGTTGGACACACGGGAACCAAAGGAGAGAGTGGCCGACTGC
AT
CACTATCAAGATGGAATCAGAGCAGCTAAAAGAAATATTCAGGTTGAAATCCAGGTGGCTGTTCATAA
G
ATTTACCAACAATTGTCTGCTACTCTAGAGAGAGCCCTTCAAGCAAATAAGCATCACATTGAAGCCCAG
CAA
CGTCTTCTTTTGGTTACAGTTTTTGCCCTCAGTGTTCATTATCAGCCAGTTGATGTTTCTTTGGCAA
TT
TCCACTGGTCTGCTGAATGTATTGTCACAGTTATGTGGAACAGACACCATGTTAGGACAGCCCCTGCA
A
TTGTTGCCAAAGACTGGTGTTTCTCAGCTTAGCACAGCTTTGAAAGTGGCCAGTACAAGGTTGCTCCAG
ATT
CTAGCCATCACTACTGGAACTTATGCTGATAAACTGAGCCCCAAAGTAGTTCAGTCCTTGTTGGATC
TA
CTCTGTAGTCAACTGAAGAATTTATTGTCTCAAACTGGTGTGCTGTTTATGGCCTCTTTTGGAGAAGG
A
GAAGAGGGTGAAGAAGAAGAAAAAAAAGTTGACTCCAGTGGAGAAGCTGAGAAGAGAGATTTCAGAGCT
GCT
CTTAGGAAACAACATGCAGCTGAACTCCATCTAGGGGATTTTTTAGTTTTTCTTCGCAGAGTTGTGT
CT
TCAAAAGCAATTCAATCAAAAATGGCTTCCCCCAAATGGACAGAAGTGCTTCTAAACATAGCATCTCA
G
AAGTGTTCTTCAGGTATTCCTCTAGTTGGTAACTTAAGAACGAGGCTTCTTGCTCTTCACGTCCTTGAG
GCT
GTGCTACCAGCTTGTGAATCTGGTGTAGAAGATGACCAAATGGCCCAGGTTGTTGAACGCTTATTTT
CC
CTTCTGTCGGATTGTATGTGGGAGACTCCCATTGCTCAGGCCAAACATGCTATTCAAATAAAGGAAAA
A
GAACAAGAAATAAAATTGCAGAAGCAAGGAGAGTTGGAGGAAGAGGATGAAAATCTCCCCATACAAGAA
GTC
TCTTTTGATCCAGAGAAGGCTCAGTGTTGCATTGTGGAAAATGGACAGATTTTAACTCATGGCAGTG
GA
GGAAAAGGATATGGATTAGCATCTACTGGGGTGACTTCTGGGTGCTATCAGTGGAAGTTTTATATTGT
G
AAGGAAAATAGAGGTAATGAAGGTACATGTGTTGGAGTCTCTCGCTGGCCAGTACATGATTTTAATCAC
CGC
ACTACCTCAGACATGTGGCTCTATAGGGCGTATAGTGGTAACCTCTATCACAATGGAGAACAGACTC
TG
ACGCTGTCCAGCTTTACTCAAGGGGATTTTATTACCTGTGTGTTAGACATGGAAGCCAGGACCATTTC
C
TTTGGGAAAAATGGAGAGGAACCCAAATTAGCCTTTGAAGATGTGGATGCAGCAGAGTTGTACCCATGT
GTA
ATGTTCTATAGCAGCAACCCGGGTGAGAAGGTGAAAATTTGTGATATGCAGATGCGTGGCACGCCAC
GG
GATTTACTTCCAGGAGACCCTATTTGTAGTCCAGTAGCAGCAGTGCTAGCTGAAGCCACTATTCAGCT
T
ATCCGTATCCTTCACCGGACAGACCGTTGGACTTACTGTATTAATAAAAAGATGATGGAAAGACTCCAT
AAA
ATTAAGATATGTATTAAAGAGTCAGGTCAGAAGCTAAAGAAAAGCCGCTCGGTTCAAAGCCGAGAGG
AA
AATGAAATGAGAGAGGAGAAAGAGAACAAAGAAGAAGAGAAAGGTAAACATAACAGGCATGGTCTTGC
T
GACCTCTCAGAACCGCAGCTGAGGACTCTTTGCATAGAGGTGTGGCCCGTGCTAGCAGTAATAGGAGGA
GTT
GATGCTGGTCTTAGAGTTGGAGGTCGGTGTGTTCACAAGCAAACTGGGCGCCATGCCACGCTGCTGG
GA
GTGGTCAAAGAAGGCAGCACATCTGCCAAGGTCCAGTGGGATGAAGCAGAGATTACCATCAGCTTCCC
A
ACTTTTTGGTCGCCTAGTGATACTCCATTATATAACCTGGAACCCTGTGAACCACTGCTGTTTGATGTG
GCG
CGATTCCGAGGCCTGACAGCTTCTGTGCTGCTGGACCTAACATATCTGACAGGCATTCATGAAGATG
TG
GGGAAACAGAGCATCAAGCGACATGAAAAGAAACACCGTCATGAGTCTGAGGAAAAGGGGGACATTGA
G
CAGAAACCTGAGAGTGAATCCATTTTAGATGTGCGAACAGGGTTAATGTCTGATGATGTCAAAAGTCAG
GGT
ACCACAAGCTCCAAATCAGAAAATGAAATAGCTTCATTTTCTTTAGAACCAACACTGCCAGGTGTGG
AA
TCCCAACATCAAATAACAGAAGGAAAGAGAAAAAATCATGAACACATATCCAAAACCCATGACATAGC
T
CAGTCAGAAATCAGAGCAGTCCAGCTTTCCTATCTCTACCTCGGTGCTATGAAGTCACTTAGTGCTCTT
CTT
GGCTGTAGTAAATATGCTGAGCTCTTGCTGATCCCAAAAGTTCTCGCTGAAAATGGCCACAACTCAG
AC
TGTGCAAGTTCTCCAGTTGTTCACGAGGATGTGGAGATGCGTGCTGCTCTACAGTTCCTGATGCGGCA
C
ATGGTGAAGCGAGCAGTCATGCGGTCACCCATAAAGCGAGCATTGGGGTTAGCTGATCTGGAACGGGCT
CAA
GCTATGATTTACAAACTGGTGGTCCATGGGCTTTTGGAAGACCAGTTTGGGGGCAAAATTAAGCAAG
AG
ATTGATCAACAAGCTGAAGAAAGTGACCAAGCACAGCAGGCACAGACACCAGTGACCACCAGCCCGTC
A
GCATCCAGCACAACTTCCTTTATGAGCAGCTCCCTCGAGGACACCACAACTGCCACCACTCCTGTCACG
GAC
ACAGAAACGGTGCCTGCATCTGAGTCCCCTGGAGTGATGCCACTTAGTCTTCTCAGGCAAATGTTTT
CT
AGTTATCCAACTACCACTGTACTTCCTACACGCCGTGCACAGACTCCTCCAATATCATCATTACCAGC
C
TCTCCTTCTGATGAAGTAGGAAGAAGGCAGAGTTTAACTTCTCCAGATTCCCAGTCTACAAGGCCAGCT
AAT
CGCACAGCCTTGTCAGACCCAAGCAGCAGACTTTCAACGTCCCCTCCTCCCCCAGCAATTGCAGTCC
CT
TTACTGGAAATGGGCTTCTCTCTTCGACAGATTGCTAAAGCCATGGAAGCTACAGGTGCTCGAGGAGA
G
GCTGATGCCCAGAGCATCACTGTTCTTGCTATGTGGATGATAGAGCACCCTGGGCATGAGGATGAGGAG
GAG
CCCCAGCCCAGCAGCACAGCAGACTCCAGACATGGAGCGACAGTTCTGGGAAGTGGTGGGAAGTCAA
AT
GATCCCTGTTATTTACAGTCACCAGGAGACATACCATCAGCTGATGCTGCTGAAATGGAGGAAGGCTT
T
AGTGAAAGCCCTGATAATCTGGATCATACAGAGAACGCAGCTTCTGGAAGTGGACCACCAACTAGAGGT
CGC
TCAACAGTAACAAGAAGGCACAAATTTGACTTAGCAGCGCGCACTCTGCTTGCAAGAGCAGCGGGGT
TA
TACCGCTCTGTGCAGGCTCACAGGAATCAAAGTCGGAGAGAAGGAATATCTTTGCAGCAAGACCCAGG
G
GCGTTGTATGACTTTAATTTAGATGAGGAATTGGAAATTGATCTTGATGATGAAGCAATGGAAGCTATG
TTT
GGACAAGACCTGACCAGTGACAATGATATTCTGGGAATGTGGATCCCAGAGGTACTGGATTGGCCTA
CC
TGGCATGTTTGTGAGTCTGAAGACAGGGAAGAAGTGGTCGTGTGTGAACTTTGCGAATGCAATGTCGT
C
AGCTTCAACCAGCACATGAAGAGAAACCACCCTGGCTGTGGGCGCAGTGCAAACCGCCAGGGGTATCGC
AGC
AATGGCTCCTATGTGGATGGCTGGTTTGGTGGTGAATGTGGGAGTGGAAATCCATACTACCTGCTGT
GT
GGCAGCTGCAGGGAGAAGTACTTAGCCCTGAAGACCAAGACCAAGACTACAAATTCTGAAAGGTACAA
G
GGACAAGCCCCAGATCTAATTGGCAAGCAGGACAGTGTGTATGAAGAAGACTGGGACATGTTAGATGTT
GAT
GAAGATGAAAAACTAACAGGTGAAGAAGAATTTGAATTGCTTGCTGGACCACTTGGTTTAAATGACC
GG
CGCATTGTGCCAGAACCAGTTCAGTTCCCTGACAGTGACCCCCTGGGAGCATCAGTAGCAATGGTCAC
A
GCTACCAACAGTATGGAAGAGACTTTGATGCAAATTGGTTGCCATGGGTCTGTGGAAAAGAGTTCCTCT
GGG
AGAGTAACATTAGGAGAGCAGGCAGCAGCCCTTGCAAATCCTCATGACCGAGTAGTGGCTTTAAGGA
GG
GTGACTGCTGCCGCTCAAGTCCTTCTGGCCAGAACCATGGTCATGCGAGCACTGTCTCTTCTCTCAGT
C
AGTGGTTCCAGTTGTAGCCTGGCTGCTGGTCTCGAGTCTCTGGGGTTAACAGATATCCGTACACTGGTT
CGG
TTAATGTGCTTAGCTGCAGCAGGGAGAGCTGGCCTTTCCACCAGCCCTTCTGCCATAGCCAGTACCT
CA
GAACGTTCACGAGGTGGACACAGTAAGGCCAGCAAGCCCATTTCTTGCCTGGCCTACCTGAGCACAGC
A
GTGGGATGCCTGGCATCAAATACTCCAAGTGCTGCAAAGCTGCTGGTCCAGCTGTGTACACAGAACTTG
ATT
TCTGCTGCAACAGGTGTCAATCTCACCACAGTGGATGATCCCATTCAGCGGAAGTTCCTACCAAGCT
TT
CTCCGTGGAATTGCTGAAGAGAATAAGCTTGTAACATCCCCAAACTTTGTTGTAACTCAAGCCCTTGT
G
GCATTATTGGCAGACAAAGGGGCCAAACTGAGACCTAACTATGATAAGACAGAAATAGAAAAAAAAGGC
CCT
CTGGAGCTGGCTAATGCCCTGGCAGCCTGCTGCCTCTCCTCTAGGCTATCCTCACAGCATAGGCAAT
GG
GCTGCTCAACAACTTGTGCGCACTCTTGCTGCACATGACCGTGACAACCAAACTGCTCCACAAACACT
T
GCTGATATGGGAGGAGATCTCAGAAAATGCTCTTTTATCAAGTTGGAGGCTCACCAAAACAGAGTAATG
ACA
TGTGTTTGGTGTAATAAAAAAGGCCTATTGGCTACCAGTGGCAATGATGGCACTATTCGGGTGTGGA
AT
GTTACCAAGAAGCAATACTCACTACAGCAAACCTGTGTGTTCAATAGACTGGAAGGGGATGCTGAGGA
A
AGCCTTGGGTCACCCAGCGACCCAAGCTTCTCACCTGTTTCCTGGAGTATCAGTGGCAAATACCTTGCT
GGG
GCTTTGGAGAAGATGGTGAACATCTGGCAAGTTAATGGAGGAAAAGGATTAGTAGATATTCAGCCTC
AC
TGGGTATCTGCCCTGGCCTGGCCAGAAGAAGGTCCAGCTACAACCTGGTCAGGAGAGTCTCCAGAGTT
A
CTGCTGGTGGGACGGATGGACGGATCTCTAGGACTGATTGAAGTTGTTGATGTGTCCACTATGCACCGC
CGA
GAACTGGAACACTGCTATCGAAAGGATGTATCTGTCACCTGCATTGCTTGGTTCAGTGAAGACAGAC
CA
TTTGCAGTAGGTTATTTTGATGGAAAATTGTTAATGGGAACAAAAGAACCACTTGAGAAAGGAGGCAT
T
GTTCTTATTGATGCACATAAGGAAACTCTTGTTAGTATGAAATGGGACCCAACAGGCCATATTCTCATG
ACA
TGTGCCAAAGAAGAAAATGTGAAACTCTGGGGGCCTGTTTCAGGATGCTGGCGCTGTCTACATTCAC
TC
TGCCATCCATCCACTGTAAATGGCATCGCCTGGTGCAGCCTTCCAGGGAAAGGATCCAAGATGCAGTT
A
CTGATGGCCACTGGCTGTCAAAATGGCTTAGTGTGTGTTTGGCGTATTCCTCAAGATACCACACAGACC
AGT
ATGACTAGCTCAGAAGGATGGTGGGACCAGGAATCAAATTGTCAGGATGGCTATAGGAAATCGGCAG
GA
GCCAAGTGTGTTTATCAGCTGCGGGGACACATCACACCTGTTCGGACTGTGGCCTTCAGTTCTGATGG
C
TTGGCCTTGGTGTCTGGTGGACTTGGAGGGCTTATGAACATTTGGTCTTTAAGGGATGGCTCTGTCTTG
CAA
ACTGTTGTAATCGGCTCTGGAGCTATTCAGACCACAGTATGGATTCCAGAAGTTGGGGTAGCTGCCT
GC
TCAAATAGATCAAAGGATGTTTTGGTTGTTAATTGCACAGCAGAATGGGCTTCTGCCAATCACATTTT
A
GCAACTTGTAGAACAGCCCTGAAACAACAGGGTGTTCTGGGATTAAACATGGCTCCCTGCATGAGAGCA
TTT
CTGGAACGGCTACCCATGATGCTTCAAGAGCAATATGCCTATGAAAAGCCTCATGTAGTTTGTGGTG
AC
CAGCTTGTTCATAGCCCCTACATGCAATGTTTGGCTTCCCTTGCTGTGGGACTTCATCTGGATCAGCT
G
TTGTGTAACCCTCCAGTGCCACCACACCATCAGAACTGTCTCCCTGACCCTACATCCTGGAATCCCAAT
GAG
TGGGCCTGGTTAGAATGCTTTTCAACCACTATCAAGGCTGCAGAGGCCCTCACCAACGGAGCGCAGT
TT
CCAGAGTCATTTACTGTCCCAGATCTAGAGCCTGTTCCTGAGGATGAGCTAGTGCTCCTCATGGATAA
C
AGCAAGTGGATCAATGGCATGGATGAACAAATTATGTCTTGGGCAACTTCCAGACCTGAGGACTGGCAC
CTG
GGAGGTAAATGTGATGTCTACTTATGGGGTGCTGGCAGGCATGGACAGCTGGCCGAAGCTGGAAGAA
AC
GTAATGGTACCAGCTACAGCGCCTTCATTCTCACAAGCCCAACAGGTTATATGTGGTCAGAACTGTAC
C
TTTGTCATCCAGGCCAATGGGACAGTGTTGGCTTGTGGGGAAGGAAGTTATGGCAGATTAGGGCAAGGA
AAT
TCAGACGACCTTCATGTGCTGACTGTGATTTCAGCCCTACAAGGTTTTGTGGTGACCCAGCTGGTGA
CT
TCCTGTGGCTCAGATGGGCACTCAATGGCCTTGACAGAAAGTGGTGAAGTCTTTAGCTGGGGAGATGG
G
GACTATGGCAAACTTGGCCATGGAAACAGTGACAGACAGCGGCGACCAAGGCAGATTGAGGCCTTACAA
GGA
GAAGAAGTGGTACAGATGTCTTGTGGCTTCAAGCATTCAGCAGTGGTAACATCGGATGGCAAACTCT
TT
ACCTTTGGGAACGGTGACTATGGCCGTCTGGGTCTTGGAAACACCTCTAACAAAAAACTTCCAGAGAG
A
GTGACCGCGCTGGAGGGATATCAGATTGGACAGGTGGCCTGTGGGCTGAACCACACCTTGGCAGTGTCA
GCA
GATGGCTCCATGGTGTGGGCCTTTGGAGATGGAGACTATGGTAAACTGGGCCTAGGAAATTCCACAG
CA
AAGTCTTCTCCTCAGAAAGTTGATGTCCTCTGTGGAATTGGAATTAAAAAGGTTGCTTGTGGAACTCA
G
TTTTCTGTGGCTTTGACTAAAGATGGTCATGTGTACACTTTTGGTCAAGACCGATTGATAGGCTTGCCT
GAG
GGACGTGCTCGTAATCATAATCGACCCCAACAAATCCCTGTCCTGGCTGGAGTGGTCATTGAAGATG
TG
GCTGTTGGAGCTGAACACACACTTGCTTTGGCATCAACTGGAGATGTTTATGCCTGGGGTAGCAATTC
A
GAAGGGCAGCTTGGCCTAGGCCACACCAACCACGTTCGAGAACCAACCCTGGTAACAGTTCTGCAAGGG
AAA
AACATCCGCCAGATTTCAGCGGGCCGTTGCCACAGTGCTGCATGGACAGCCCCACCAGTCCCACCAA
GA
GCACCAGGTGTGTCAGTGCCTCTCCAGTTGGGCCTGCCTGACGCAGTGCCCCCACAGTATGGGGCACT
G
AGAGAGGTGAGCATTCACACCGTGCGAGCAAGGCTCCGGCTGCTCTACCACTTCTCTGACCTCATGTAC
TCA
TCATGGAGGTTGCTGAATCTCAGCCCCAACAACCAGAACAGCACATCTCATTACAATGCTGGAACAT
GG
GGCATTGTACAGGGACAACTTCGGCCTCTGTTAGCTCCAAGAGTCTACACACTCCCCATGGTGCGCTC
C
ATAGGGAAGACCATGGTTCAAGGCAAAAATTATGGGCCTCAGATTACTGTAAAGAGAATATCAACCAGA
GGA
CGGAAGTGTAAGCCCATCTTTGTTCAAATAGCAAGACAAGTGGTAAAGCTAAATGCATCAGACCTCC
GT
CTACCCTCCCGAGCATGGAAGGTTAAGCTGGTTGGAGAAGGAGCTGATGATGCTGGAGGAGTGTTTGA
T
GACACTATCACAGAAATGTGCCAGGAACTTGAGACTGGAATAGTTGACCTTCTCATACCCTCTCCTAAT
GCT
ACTGCAGAAGTCGGTTACAACAGAGACAGGTTCCTTTTTAATCCCTCTGCCTGCCTTGATGAACATT
TA
ATGCAGTTTAAGTTCTTAGGAATTTTAATGGGGGTTGCCATTCGTACAAAGAAGCCTCTGGACCTTCA
C
CTGGCCCCTCTGGTGTGGAAACAGCTGTGCTGTGTCCCACTTACCCTGGAGGACCTGGAGGAAGTGGAT
CTG
CTTTATGTGCAGACCCTTAACAGCATCCTTCACATTGAAGACAGTGGCATTACTGAAGAGAGTTTCC
AT
GAGATGATTCCTCTTGATTCTTTTGTCGGCCAGAGTGCTGATGGTAAAATGGTCCCCATAATCCCTGG
A
GGAAATAGTATCCCACTCACGTTTTCCAATAGGAAGGAGTACGTAGAGAGGGCCATTGAGTATCGACTT
CAT
GAGATGGACCGGCAGGTGGCTGCAGTTCGAGAAGGGATGTCCTGGATTGTCCCTGTACCATTGCTGT
CC
CTCCTCACGGCCAAACAGCTGGAACAGATGGTGTGTGGGATGCCTGAGATCTGTGTGGATGTCCTGAA
G
AAGGTGGTGCGATACCGTGAGGTGGACGAGCAGCACCAGCTGGTGCAGTGGCTCTGGCGCACACTGGAA
GAG
TTCTCCAATGAGGAGCGGGTGCTCTTCATGCGCTTCGTGTCTGGGCGCTCCCGACTGCCAGCCAACA
CC
GCTGACATTTCCCAGAGGTTTCAAATCATGAAGGTCGATAGGCCTTATGACAGTCTGCCTACCTCACA
G
ACCTGCTTCTTCCAGCTGCGGCTGCCCCCCTATTCCAGCCAGCTGGTCATGGCTGAGCGCTTGAGATAT
GCC
ATCAACAACTGCCGTTCAATTGACATGGACAACTACATGCTCTCAAGAAATGTGGACAATGCAGAGG
GC
TCTGACACTGACTACTGA


Translation (4859 aa):
MATMVPPVKLKWLEHLNSSWITEDSESIATREGVTVLYSKLISNKEVVPLPQQVLCLKGPQLPDFERESL
S
SDEQDHYLDALLSSQLALAKMVCSDSPFAGALRKRLLVLQRVFYALSNKYHDKGKVKQQQHSPESSSGS
A
DVHSVSERPRSSTDALIEMGVRTGLSLLFALLRQSWMMPVSGPGLSLCNDVIHTAIEVVSSLPPLSLAN
E
SKIPPMGLDCLSQVTTFLKGVTIPNSGADTLGRRLASELLLGLAAQRGSLRYLLEWIEMALGASAVVYT
M
EKNKLLSSQEGMISFDCFMAILMQMRRSL
GSSADRSQWREPTRTSEGLCSLYEAALCLFEEVCRMASDY
S
RTCASPDSIQTGDAPIVSETCEVYVWGSNSSHQLVEGTQEKILQPKLAPSFSDAQT
IEAGQYCTFVIST
D
GSVRACGKGSYGRLGLGDSNNQSTLKKLTFEPHRSIKKVSSSKGSDGHTLAFTTEGEVFSWGDGDYGKL
G
HGNSSTQKYPKLIQGPLQGK
VVVCVSAGYRHSAAVTEDGELYTWGEGDFGRLGHGDSNSRNIPTLVKDI
S
NVGEVSCGSSHTIALSKDGRTVWSFGGGDN
GKLGHGDTNRVYKPKVIEALQGMFIRKVCAGSQSSLALT
S
TGQ
VYAWGCGACLGCGSSEATALRPKLIEELAATRIVDISIGDSHCLSLSHDNEVYAWGNNSMGQCGQG
N
STGPITKPKKVSGLDGIAIQQISAGTSHSLAWTALPRD
RQVVAWHRPYCVDLEESTFSHLRSFLERYCD
K
INSEIPPLPFPSS
REHHNFLKLCLKLLSNHLALALAGGVATSILGRQAGPLRNLLFRLMDSTVPDEIQE
V
VIETLSVGATMLLPPLRERMELLHSLLPQGPDRWESLSKGQ
RMQLDIILTSLQDHTHVASLLGYSSPSD
A
ADLSTVCMGYGNLSDQPYGSQICHPDTHLAEILMKTLLRNLGFYT
DQAFGELEKNSDKYLLGTSSSENS
Q
PAHLHELLCSLQKQLLAFCHINNVTE
NSSSVALLHKHLQLLLPHATDIYSRSANLLKESPWNGSVGEKL
R
DVIYVSAAGSMLCQIVNSLLLLPVSVARPLLSYLLDLLPPLDCLNRLLPAAALLEDQELQWPLHGGPEV
I
DPAGVPLPQPAQSWVWLVDLERTIALLIGRCLGGMLQGSPVSPEEQDTAYWMKTPLFSDGVEMDTPQL
D
K
CMSCLLEVALSGNEEQKPFDYKLRPEVAVYVDLALGCSKEPARSLWISMQDYAVSK
DWDSATLSNESLL
D
TVSRFVLAALLKHTNLLSQACGES
RYQPGKSLSEVYRCVYKVRSRLLACKNLELIQTRSSSRDRWITDN
Q
DSADVDPQEHSFTRTIDEEAEMEELAERDREDGHPEPEDEEEEREHEVMTAG
KIFQCFLSAREVARSRD
R
DRMNSGAGSGVRADDPPPQSQQERRVSTDLPEGQDVYTAACNSVIHRCALLILGVSPVIDELQKRREEG
Q
LQQPSVSASEGTGLMT
RSESLTAESRLVHASPSYRLIKSRSESDLSQPESDEEGYALSGRRNVDFDLAS
S
HRKR
GPMHSQLESLSDSWTRLKHTRDWFYNSSYSFESDFDLTKSLGVHTLIENVVSFVSGDVGNAPGFK
E
PEESMSTSPQASIIAMEQQQLRAE
LRLEALHQILTLLSGMEEKGNVLLTGSRSSSGFQSSTLLTSVRLQ
F
LAGCFGLGTVGHTGTKGESGRLHHYQ
DGIRAAKRNIQVEIQVAVHKIYQQLSATLERALQANKHHIEAQ
Q
RLLLVTVFALSVHYQPVDVSLAISTGLLNVLSQLCGTDTMLGQPLQLLPKTGVSQLSTALKVASTRLLQ
I
LAITT
GTYADKLSPKVVQSLLDLLCSQLKNLLSQTGVLFMASFGEGEEGEEEEKKVDSSGEAEKRDFRA
A
LRKQHAAELHLGDFLVFLRRVVSSKAIQSKMASPKWTEVLLNIASQKCSS
GIPLVGNLRTRLLALHVLE
A
VLPACESGVEDDQMAQ
VVERLFSLLSDCMWETPIAQAKHAIQIKEKEQEIKLQKQGELEEEDENLPIQE
V
SFDPEKAQCCIVENGQILTHGSGGKGYGLASTGVTSGCYQWK
FYIVKENRGNEGTCVGVSRWPVHDFNH
R
TTSDMWLYRAYSGNLYHNGEQTLTLSSFTQGDFITCVLDMEARTISFGKNGE
EPKLAFEDVDAAELYPC
V
MFYSSNPGEK
VKICDMQMRGTPRDLLPGDPICSPVAAVLAEATIQLIRILHRTDRWTYCINKKMMERLH
K
IKICIKESGQKLKKSRSVQSREENEMREEKENKEEEKGKHNR