NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS52804.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
52804.1 Public Mus musculus 9 Peak1 23 108 98 CCDS HistoryNCBI Gene:244895Re-query CCDS DB by CCDS ID:52804.1Re-query CCDS DB by GeneID:244895See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 52804.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000061552.14 ENSMUSP00000109901.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000061552.14Link to Ensembl Protein Viewer:ENSMUSP00000109901.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000061552Re-query CCDS DB by Protein ID:ENSMUSP00000109901
Original member Current member NCBI NM_172924.3 NP_766512.2 Accepted alive Link to Nucleotide Sequence:NM_172924.3Link to Protein Sequence:NP_766512.2Re-query CCDS DB by Nucleotide ID:NM_172924Re-query CCDS DB by Protein ID:NP_766512Link to BLAST:NP_766512.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_766512.2 1735 Q69Z38 1735 100% 0 0

Chromosomal Locations for CCDS 52804.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 56206448 56207611 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 56227102 56227844 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 56241160 56241344 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 56257527 56260642 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5208 nt):
ATGTCTGCTTGTAACACCTTTACTGAACACGTTTGGAAACCTGGCGAATGCAAGAATTGCTTTAAACCTA
AA
AGCTTGCACCAGCTTCCTCCAGACTCTGAGAAGACGCCCATCACCCACGGCAGTGGGAAAACTAATGC
C
AATCACAGTAACAACCACCGAGTCAGGAGCACGGGCAACTTCCGGCCCCCTGTGGCTAAAAAGCCCACC
ATC
GCTGTGAAGCCCACTATGATGGTGGCAGATGGGCAAAGCGTGTGTGGCGAGCTAAGCATCCAGGAAC
AC
TGTGAGAACAAGCCTGTCATCCTGGGGTGGAACCAAAACAAGACGTCCCTGAGCCAGAAACCACTTAA
C
AACAATTCTGAAGGTGATGCTGAAGGCTTTGGCAGTGATCCTCAGCAGTGTGCCAATAATGACAGTGCA
CAG
AAGATATCCAATAACAACAACGGGCTAACTGAAGTGCTAAAGGAGATAGCGGGCCTGGAAGCCACCC
CT
CCGGTCAGAGGAAATGAAACAAACGCCAGAGAAACATTCTTGGGAAGAATAAATGATTGCTACAAACG
A
TCGTTGGAAAGAAAGATCCCACCCAGTTGCATGACCGGGAGCATGAAGGACTCTCAGGGCAAACACGTC
ATC
CTGAGCGGGAGCGCCGAGGTCATCAGTAACGAAGGGGGCAGGTTCTGCTACCCTGAGTTCTCCAGTG
GT
GAGGAGAGTGAGGAAGATGTGCTTTTCAGTAACATGGAGGAGGAGCATGAGAGCTGGGATGAGAGCGA
T
GAAGAGCTGTTGGCCATGGAGATTCGCATGAGAGGGCAGCCTCGCTTTGCTAACTTCAGGGCAAACACC
CTG
TCTCCTGTTCGATTCTTTGTGAGCAAAAAGTGGAATACTATCCCCTTACGGAATAAGTCTCTGCAGA
GA
ATCTGTGCTGTGGACTATGACGACAGCTATGATGAAATCCTGAATGGTTATGAGGAAAATTCTGGGGT
C
TCCTATGGTCAAGGAAGCGTTCAGAGCACAATATCATCTGACTGCACATCACCAGGCTCCTCCTTCACA
GAA
GAGTCACGCTCTGAAACAGCCAGCAGTTTATCCCAGAAGGTCTGTAATGGGGGGATATCTCCTGGTA
AC
CCAGGAAATTCTAAGGACATAGCAGAAACTGAGTCTAATTTTGAAAGTCCTCCTGGTAACAATGAGGA
G
AAGGACGAATCACTGACTTCCAAAAGCTCGGTGAAAGTTCCAGAGACGCACAAAGCTGTCCTTGCTCTC
CGT
TTACAGGAGAAGGATGGCAAGATTGCAGTACATACTGAGAAGCCAGAGAGCAAAGCTTCTACAGATA
TC
GCTGGCCAGGCAGTCACCATAAGCCTCGTCCCAGTAGAAGAACAGACAAAGCCCTACCGTGTGGTAAA
T
CTGGAACAGCCGCTGTGTAAGCCATATACCGTTGTGGATGTGTCGGCAGCCATGGCCAGCGAGCACCTG
GGG
CGACCCAAGATAAAAGGTTCATCTTCTACTCCAAACTCTCCAGTTACATCACCTGCATTGACACCAG
GA
CAAATAAATGCCCATCTCAAAAAATCCAGTGCAATCCGATACCAGGAAGTGTGGACGTCCAGCACCAG
T
CCACGACAAAAGATCCCTAAAATAGAATTAAGTACTGGGGGACCTGGGCCAAATGTCCCTCCAAGGAAA
AAC
TGCCATAAGTCGGCGCCCACTTCACCCACGGCTACAAACATCTCCTCTAAAACCATCCCTGTTAAGT
CA
CCTAATTTGTCTGAAATAAAATTTAATAGTTACAACAATGCCGGGATGCCACCTTTTCCCATTATCAT
C
CATGATGAGCCATCCTATGCCCGGAGTTCCAAAAATGCCATTAAAGTCCCCATTGTTATTAATCCAAAT
GCG
TATGACAATCTCGCCATCTACAAAAGTTTTCTGGGAACAAGTGGAGAACTCTCTGTGAAGGAAAAAA
CC
ACAAGCGTAATAAGCCATACTTACGAAGAAATAGAAACTGAAAGCAAAGTGTCTGATAGCACCCCCAG
C
AAGCTCACAGACTGTCCCCAAGCTAAAGGGTTTTCCAACAGCACAGAGCGGAAAAGAGGCTCAGTAGCG
CAG
AAGGTGCAGGAGTTTAACAATTGTCTCAACAGAGGTCAGTCTTCTCCACAAAGAAGCTACAGTTCCA
CC
CACAGCTCCCCAGCAAAAATCCAGAGACCCACTCAAGAGCCTGCGGGCAAAACGGAAGGGGCACAAGG
G
TCTCAGGTGCCAGGCAGCAGCAGCAACAGCACTAGGGAGAAAGCAAGCGCCGTCCTATGTCAGATTGTG
GCA
TCTATCCAACCCCCCCAGACTCCTCCAGAAGCACCTCAATCTAGCCCTAAGGCTTGCAGTGTGGAAG
AG
CTTTATGCCGTTCCCCCAGATGCAGATACTACAAAAAGTATTCCTAAAAACCCACCAGTCAGACCCAA
A
TCTCTTTTTACATCTCAGTCTAGTGGGGAAGGTGAGGCCCATCAGACCACAGAAAGCCCTACTGCCAAA
ATT
CAGAAAGATCCATCCACGAAGCCAGTGACTTCTCCTCCCTCCAAATTAGTGACGAGCGCCCAGAGTG
AG
CCACCGCCTCCCTTTCCCCCACCACGGTCTACTTCCTCCCCTTACCATGCAAGTAACCTGTTGCAAAG
G
CATTTTACCAATTGGACGAAGCCAACCAGTCCTACCCGATCAACAGAAGCTGAATCAATTTTGCACTCT
GAA
GGCAGCAGGCGAGCCGCTGATGCAAAACCTAAACGCTGGATATCATTTAAAAGCTTCTTCCGCCGCC
GC
AAAACAGATGAGGAAGAAGAGAAGGAGAAAGAGCGAGAGAAAGGGAAGCTGGTGGGCCTGGACGGGAC
A
GTCATCCACATGCTGCCGCCCCCTCCAGTCCAGCGCCATCACTGGTTCACAGAGGCCAAAGGAGAGGCC
AGC
GAGAAGCCTGCTATAGTCTTCATGTACAGGTGTGACCCTGACCAAGGCCACCTCAGTGTGGACCAAA
GC
AAGGCTGGGGCAGAGAAAGGAAGAGCAGAGGAGGTGTTACTGCGGAACTCGGAAGAGAAGAAAAGTAG
C
TATCTTCCATCACAGATTCCTGACAAAGCTTGCAGTCGTGTGACCCATGAAGTGGCAGGAGAACTTTCT
CCT
CGGGATCCAAGAACTCCTGCTGGGAAGCAAGATGGCACTTCAGTCACACCAACACTGCCTCCACCTG
AC
CTGGAAAGGGAAGAAGAAAAAGATGACACTTTGGATCCTACTGACGTGAGTCCCTGCAGTGCAACCTA
C
AGCAACCTAGGACAATCTCGAGCAGCTATGATACCTCCCAAGCATCCACGGCATCCCAAGGGAGCGGTG
GAT
GATGCCATTGCCTTTGGAGAGAAGACAGACCAAGAAGGACTGAATGCTTCCCAACCCACACCACCCC
CA
CTGCCAAAGAAAATGATACGAGCCAATACCGAGCCCATCTCCAAAGACCTTCAGAAAGCCATGGAAAG
C
AGTCTTTGCGTCATGGCTAATCCCACCTACGATATTGATCCCAACTGGGATGCCAGCAGTGCTGGGTCT
TCT
ATTAGCTATGAACTCAAGGGACTAGACGTTGAGTCTTATGAATCCTTGGAGAGACCTTTGCATAAGG
AG
AGACCCGTTCCTTCAGCAGCAAACAGTATCTCCAGCCTAGCCACTCTCAGTGTTAAGGACAGATTTTC
T
AACAGTATGGAGTCACTCTCCAGTCGACGTGGTCTCTCCTATAGACAGACTCGAAGCATCCAGAAGCCA
CAG
AGACAAGCACTTTATCGAGGACTTGACAATCGGGAGGAAGTGGTGGGTAAACTCCGAAGCCTTCATA
CA
GATGCCTTGAAGAGACTGGCAGTTAAATGTGAAGACCTCTTCATGGCTGGGCAGAAAGACCAACTCCG
C
TTTGGAGTAGACAGCTGGTCAGACTTCAGGCTAACCAGCGACAAACCGTGCTGCGAAGCTGGAGATGCG
GTT
TACTACACTGCCTCGTATGCAAAAGATCCACTCAGTAACTATGCAGTCAAGATCTGCAAGAGCAAAG
CT
AAGGAGTCTCAGCAGTATTACCATAGCCTGGCTGTCCGGCAGAGTCTGCCTGTGCATTTTAACATCCA
G
CAGGATTGTGGCCATTTCCTTGCTGAAGTCCCTAGTCGTCTGCTTCCCTGGGAGGATCCTGATGCTCCT
GAA
AAGGCAGAGGATGGCACTGAAGACAGCGAAGAAGAGGGGAAGGCAGAAACTTTGGGGGGAAATCCTG
AG
CCCTGCTCTGAAACAGAGCCATCCCAGAAAGAGAACCAACGAGTCACAAACAGGAAACAAAGAAGCCA
C
GTTGTGGTCATCACCAGGGAGGTTCCCCATCTCACTGTGGCCGACTTCGTGCGAGATTCTTTGGCCCAT
CAT
GGGAACAGCCCTGACTTGTATGAGAGGCAAGTGTGTCTGCTGCTCTTACAGCTGTGCTCTGGGCTTG
AG
CACCTCAAGCCCTACCACGTCACGCACTGCGATCTTCGCCTGGAGAACTTGCTGCTTGTCCAGCACCA
A
CCTGGGGGAGCTGCCCAGGGCCCTTCTCCTGCAGACCCTTGCCCCACCTTAGCTTGTCCTACAAGGCTC
ATT
GTGAGTAACTTCTCTCAGGCCAAGCAGAAGAGCCACCTGGTGGACCCCCAGATCCTCCGAGACCAGT
CC
CGCCTTGCCCCAGAGATCATCACGGCCACCCAGTATAAGAAGTGTGATGAATTCCAGACGGGCATTCT
C
ATCTATGAGATGCTGCACCTGCCCAACCCTTTTGACGAGAACCCGGAGCTGAAGGAGAAGGAGTACACG
CGC
ACAGATCTGCCTCGGATCCCTCTCCGCTCCCCGTACTCCTGGGGTCTACAGCAGCTTGCTAGCTGCC
TC
CTGAATCCCAACCCTTCTGAGCGCATCCTCATTTCTGACGCCAAAGGCATCCTCCAATGTCTGCTCTG
G
GGCCCCCGAGAAGATCTCTTTCAAATCTTCACCACCTCTGCAACCCTCGCACAGAAGAACGCTCTGCTC
CAA
AACTGGTTAGACATCAAGCGAACCCTGCTGATGATCAAGTTCGCGGAGAAGTCCCTGGACAGAGAGG
GG
GGCATCAGCCTGGAGGACTGGCTTTGTGCTCAGTATCTGGCCTTTGCCACTACAGACTCCCTGAGCTA
T
ATTGTAAAAATCCTGCAATACCGTTAA


Translation (1735 aa):
MSACNTFTEHVWKPGECKNCFKPKSLHQLPPDSEKTPITHGSGKTNANHSNNHRVRSTGNFRPPVAKKPT
I
AVKPTMMVADGQSVCGELSIQEHCENKPVILGWNQNKTSLSQKPLNNNSEGDAEGFGSDPQQCANNDSA
Q
KISNNNNGLTEVLKEIAGLEATPPVRGNETNARETFLGRINDCYKRSLERKIPPSCMTGSMKDSQGKHV
I
LSGSAEVISNEGGRFCYPEFSSGEESEEDVLFSNMEEEHESWDESDEELLAMEIRMRGQPRFANFRANT
L
SPVRFFVSKKWNTIPLRNKSLQRICAVDYDDSYDEILNGYEENSGVSYGQGSVQSTISSDCTSPGSSFT
E
ESRSETASSLSQKVCNGGISPGNPGNSKDIAETESNFESPPGNNEEKDESLTSKSSVKVPETHKAVLAL
R
LQEKDGKIAVHTEKPESKASTDIAGQAVTISLVPVEEQTKPYRVVNLEQPLCKPYTVVDVSAAMASEHL
G
RPKIKGSSSTPNSPVTSPALTPGQINAHLKKSSAIRYQEVWTSSTSPRQKIPKIELSTGGPGPNVPPRK
N
CHKSAPTSPTATNISSKTIPVKSPNLSEIKFNSYNNAGMPPFPIIIHDEPSYARSSKNAIKVPIVINPN
A
YDNLAIYKSFLGTSGELSVKEKTTSVISHTYEEIETESKVSDSTPSKLTDCPQAKGFSNSTERKRGSVA
Q
KVQEFNNCLNRGQSSPQRSYSSTHSSPAKIQRPTQEPAGKTEGAQGSQVPGSSSNSTREKASAVLCQIV
A
SIQPPQTPPEAPQSSPKACSVEELYAVPPDADTTKSIPKNPPVRPKSLFTSQSSGEGEAHQTTESPTAK
I
QKDPSTKPVTSPPSKLVTSAQSEPPPPFPPPRSTSSPYHASNLLQRHFTNWTKPTSPTRSTEAESILHS
E
GSRRAADAKPKRWISFKSFFRRRKTDEEEEKEKEREKGKLVGLDGTVIHMLPPPPVQRHHWFTEAKGEA
S
EKPAIVFMYRCDPDQGHLSVDQSKAGAEKGRAEEVLLRNSEEKKSSYLPSQIPDKAC
SRVTHEVAGELS
P
RDPRTPAGKQDGTSVTPTLPPPDLEREEEKDDTLDPTDVSPCSATYSNL
GQSRAAMIPPKHPRHPKGAV
D
DAIAFGEKTDQEGLNASQPTPPPLPKKMIRANTEPISKDLQKAMESSLCVMANPTYDIDPNWDASSAGS
S
ISYELKGLDVESYESLERPLHKERPVPSAANSISSLATLSVKDRFSNSMESLSSRRGLSYRQTRSIQKP
Q
RQALYRGLDNREEVVGKLRSLHTDALKRLAVKCEDLFMAGQKDQLRFGVDSWSDFRLTSDKPCCEAGDA
V
YYTASYAKDPLSNYAVK
ICKSKAKESQQYYHSLAVRQSLPVHFNIQQDCGHFLAEVPSRLLPWEDPDAP
E
KAEDGTEDSEEEGKAETLGGNPEPCSETEPSQKENQRVTNRKQRSHVVVITREVPHLTVADFVRDSLAH
H
GNSPDLYERQVCLLLLQLCSGLEHLKPYHVTHCDLRLENLLLVQHQPGGAAQGPSPADPCPTLACPTRL
I
VSNFSQAKQKSHLVDPQILRDQSRLAPEIITATQYKKCDEFQTGILIYEMLHLPNPFDENPELKEKEYT
R
TDLPRIPLRSPYSWGLQQLASCLLNPNPSERILISDAKGILQCLLWGPREDLFQIFTTSATLAQKNALL
Q
NWLDIKRTLLMIKFAEKSLDREGGISLEDWLCAQYLAFATTDSLSYIVKILQYR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser