NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS52799.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
52799.1 Public Mus musculus 9 Dmxl2 23 108 98 CCDS HistoryNCBI Gene:235380Re-query CCDS DB by CCDS ID:52799.1Re-query CCDS DB by GeneID:235380See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 52799.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000118163.7 ENSMUSP00000113705.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000118163.7Link to Ensembl Protein Viewer:ENSMUSP00000113705.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000118163Re-query CCDS DB by Protein ID:ENSMUSP00000113705
Original member Current member NCBI NM_172771.2 NP_766359.2 Accepted alive Link to Nucleotide Sequence:NM_172771.2Link to Protein Sequence:NP_766359.2Re-query CCDS DB by Nucleotide ID:NM_172771Re-query CCDS DB by Protein ID:NP_766359Link to BLAST:NP_766359.2

Chromosomal Locations for CCDS 52799.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 54366418 54366627 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54367554 54367771 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54369210 54369262 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54369872 54369963 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54374653 54374730 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54375279 54375406 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54375506 54375566 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54376223 54376361 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54378714 54378835 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54378917 54379003 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54379775 54379837 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54380908 54381025 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54381853 54382054 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54382636 54382721 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54383657 54383787 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54387413 54387591 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54393628 54393876 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54396240 54396370 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54398047 54398123 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54399942 54400133 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54400917 54401986 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54403957 54404221 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54405748 54405913 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54406597 54406694 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54409151 54409320 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54411600 54411710 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54415430 54417103 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54419745 54419972 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54423230 54423349 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54426382 54426505 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54428034 54428123 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54445383 54445504 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54446372 54447065 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54450797 54451068 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54451602 54451841 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54457624 54457798 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54458854 54459037 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54460939 54461117 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54472192 54472258 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54472888 54473023 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54473837 54473915 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54477457 54477528 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54480340 54480465 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 54501351 54501437 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (9165 nt):
ATGCATCTGCATCAGGTCCTCACCGGGGCTGTCAACCCTGGGGACAACTGCTATTCGGTGGGCAGCGTCG
GG
GACGTCCCCTTCACGGCATATGGATCAGGCTGTGATATTGTTATTCTGGCGAGTGACTTTGAATGTGT
G
CAGATCATCCCTGGTGCTAAGCATGGGAACATCCAAGTCAGTTGTGTGGAATGCTCCAACCAGCATGGG
AGA
GTTGCAGCTTCATATGGGAATGCTGTGTGTATTTTTGAACCCCTGGGTGTAAATTCTCATAAGAGAA
AC
AGTCAACTCAAGTGTCAGTGGCTTAAAACTGGACAGTTTTTTTTGAGTTCCGTGACATACAACTTAGC
A
TGGGACCCTCAAGATAACAGATTGCTGACAGCAACGGATTCGATTCAGCTGTGGGCTCCTCCAGGCGGT
GAT
ATTCTAGAAGAGGAGGAAGATGTTGATAATAGAGCCCCTCCTGTTTTAAATGATTGGAAGTGCATCT
GG
CAGTGCAAAACCTCAGTGTCTGTACATCTGATGGAATGGTCTCCTGATGGTGAATACTTTGCCACTGC
T
GGAAAGGATGACTGTCTTCTGAAAGTCTGGTACCCTATGACTGGCTGGAAGTCTTCAATCATACCTCAA
GAT
CCCCATGAAGTGAAGAGGAGACGGGCTTCCACTCAGTTCTCCTTTGTTTACTTGGCACACCCTCGAG
CC
GTGACAGGTTTCTCATGGCGGAAAACTAGCAAGTATATGCCCAGGGGCTCTGTCTGTAATGTCTTACT
G
ACTTCATGTCATGATGGTGTGTGTCGGCTCTGGGCAGAAACATTGTTACCTGAAGACTGCCTTTTGGGT
GAG
CAGATTTGTGAGACCACTACCTCCAGCGTTGCCAGCAACCTCTCTTCTGCTGGGAAACACAAAGACA
GG
ATCCAGCATGCTCTTGAGACAATACACCATTTGAAGAATTTAAGGAAAGGACAAAGGAGGTCTTCTGT
T
CTTGTAACTCACGCTGAACTGATGCCTGACAAGACTGCAACCCACGAGGTTCACAGACACATTTCTCAC
CAT
GCCAACGCACTGTGCCACTTTCACATCGCGGCGAGCATCAATCCTACTACAGATATTCCAAATGTCC
TG
GTTGGCACTGCATTTAATATTGATGATATCAATGGAGGATTTGTAGTTCATTGGTTAAATAACAAGGA
A
TTTCATTTTACATCATCAACTGAAATATTTATGCACCAATTACGAAAACTTTCTGAAAAACAATTAGAT
CAT
GAAAGTGATGATGCAGATAGAGAAGATGAGGAGCGCTCACAGGACGAGAGAGAGAGGGGCTTACGCA
TG
AAACTGGACCATGAATTATCTCTGGATAGAGAATCTGAGGCAGGTACAGGATCATCAGAACATGAAGA
T
GGAGAACGAGAGGGAAGTCCTAGAACCCATCCACGACCTAGCATCTCAATGCCACTGCCTACAGTACTG
CTG
GACCGGAAGATTGAAACGCTGCTGACAGAGTGGAACAAGAACCCTGACATGTTATTCACGATACACC
CT
GTAGATGGAACTTTTCTAGTGTGGCATGTAAAGTATTTGGATGAATATAACCCTGGAATATTTAGACA
A
GTTCAGGTTTCTTTTTCCTCTCGGATTCCTGTTGCATTTCCCTCTGGGGACGCCAACTCTCTTAGTAAA
AAC
ATCATGATGTATGCTTGTGTGAATGCTACAAAAGATTCATACAACCCATCCCAGCAAGAGATGATGT
CT
GTAGATAGTCCCCATGGATCACAGCTACACTCTCCATCACACAGCACCGATATGAATATTTTAGCACC
T
ACGGTAATGATGGTCTCTAAACACATAGATGGGTCTTTGAATCAGTGGGCAGTCACGTTTGCTGACAAG
TCA
GCCTTTACCACTGTTCTGACTGTGTCCCACAAATTCAGATACTGTGGTCACCGATTCCACCTCAATG
AC
CTGGCATGCCATTCTGTTTTACCCCTCTTGCTGACATCTTCCCATCATAATGCTCTGTTGACTCCTGA
A
TCAGACTGTCAGTGGGACTCCGACAGTAAAGTAAATAGATTAATAGATCCTGTAAAACACACAAAAGCT
TCA
TCAAAACAGCCTCTGAGAAATGCAGCAACCCGTACATTTCATGACCCAAATGCAATCTACAGTGAAC
TT
ATTTTGTGGCGTGTAGACCCCATTGGACCTTTGTCATATACTGGAGGAGTGTCAGAATTGGCTCGAAT
T
AACTCTTTACATACCTCAGCCTTCTCTAATGTGGCATGGCTTCCAACTCTTATTCCTAGTTACTGTCTT
G
GC
ACATACTGCAATTCTGCAAGTGCTTGCTTTGTTGCATCTGATGGCAAAAATCTAAGACTCTATCAAG
CT
GTGGTCGATGCAAGAAAATTATTAGATGAACTGTCAGACCCAGAAGCCTCAAAACTGATCGGAGAAGT
G
TTTAACATTGTGAGCCAACAGTCCACTGCTCGTCCAGGCTGCATTATTGAGCTTGATGCCATAACTGAC
CAA
TGTGGATCAAATACACAGCTACTGCACGTGTTTCAAGAAGACTTCATTATTGGATATAAGCCACACA
AA
GAAGATATGGAGAAAAAGGAAAAGGAGTCAGAAATATTTTTCCAGCCATCACAAGGATATCGACCACC
A
CCATTTTCAGAAAAATTCTTTTTAGTAGTCATTGAGAAGGATGGAAATAATAACTCTATTCTCCATATG
TGG
CACCTTCATCTTAAGTCTGTACAAGCGTGCTTAGCCAAAGCTGCAGAGGGCATCTCATCTGACAGTC
TG
CTCTCAGTCCCGGGGCAGAAGAACCTGGACTCTTCTCCAGAAACCTCCTCTAGTATGAGCTCCGTGCC
A
CATTCCTCGTCAATTGCCAATCTTCAAACTGCTAGTAAGCTTATTCTGAGCTCCAGACTTGTATATAGC
CAG
CCCCTGGATCTGCCGGAAGCTGTTGAAGTAATAAGAGCAACGCCTTCAGCAGGTCATCTGAGTTCCT
CT
TCAATTTACCCAGTGTGCCTTGCACCTTATTTAGTGGTTACAACTTGCTCCGACAATAAAGTACGCTT
C
TGGAAATGTTGTATGGAAACTAACTCACTGGGCAATACAAGTGATGAGAGTGAGACCTATCATTGGAGG
AGA
TGGCCCTTGATGAATGATGAAGGAGAAGATAACAGCAGTACTGTGAGCATCGTGGGAAGACCTGTTG
CT
GTTAGCTGCTCATACACAGGCCGCCTTGCAGTGGCTTACAAGCAACCCATCCACCACAATGGTTTTAT
T
TCTAAAGAATTCTCTATGCATGTCTGTATATTTGAATGCGAATCTACAGGAGGGTCAGAATGGGTTTTA
GAA
CAGACGATCCATCTTGATGATTTAGTTAAGGTTGGAAGTGTACTTGATTCAAGGGTCAGTGTTGACA
GT
AATCTGTTTGTATATAGCAAATCAGATGCATTTTTAAGTAAGGATAGATACCTTATTCCAAATATCAA
G
CATTTAGTACATTTGGACTGGGTGTCAAAAGAAGATGGCTCTCACATCCTCACAGTGGGGGTTGGTGCT
AAT
ATCTTCATGTATGGGAGACTTTCAGGAATTGTAAGTGACCAAACCAACAGTAAGGATGGAGTAGCTG
TC
ATCACTTTACCACTAGGTGGTAGTATCAAGCAAGGAGTTAAGTCAAGATGGGTTCTTCTGAGATCTAT
A
GACTTAGTATCCTCTGTGGATGGCACACCTTCACTGCCTGTTTCTCTCTCTTGGGTAAGAGATGGAATA
TTG
GTGGTGGGAATGGATTGTGAAATGCATGTATATGCCCAATGGAAGCATTCTGTCAAATTTGGAAACG
TT
GACGCTGATAGTCCAGTTGAAGAGACAATACAAGATCACTCTGCCCTTAAATCCTCTATGCTGGCAAG
A
AAAAGTATTGTTGAAGGAGCAGCTATCCCTGATGATGTTTTCTGTTCACCTACTGTGGTTCAAGATGGT
GGC
TTATTTGAGGCTGCACATGCACTCTCTCCTACTCTGCCACAGTATCATCCAACTCAGCTGTTAGAAT
TA
ATGGACTTAGGGAAAGTTAGAAGAGCTAAGGCCATTCTTTCCCATTTGGTAAAGTGCATCGCAGGTGA
A
GTTGCAATAGTTCGGGATCCTGATGCTGGAGAAGGAACTAAGCGGCATCTCTCTCGGACCATTAGTGTG
AGC
GGCAGTACAGCAAAGGATACAGTTACCATTGGGAAGGATGGTACTCGGGATTATACCGAGATAGACT
CT
ATTCCTCCACTACCACTACACGCATTGCTTGCTGCAGACCAGGACACATCCTACAGAATTTCAGAGGA
C
AGTACAAAAAAGCCACAGAGCTATGAGGACCATATTGAAAGCCAATCAGAGGATCAATATTCAGAGCTG
TTT
CAAGTCCAGGAGATAACAACAGATGATATTGATTTAGAGCCAGAAAAGAGAGAGAACAAATCAAAAG
TA
ATAAACCTGTCACAGTATGGACCAGCCTGTTTTGGCCAGGAACATGCTAGAGTACTTTCAAGTCATCT
A
ATGCACTCAAGTCTGCCAGGCCTTACCCGCTTGGAGCAGATGTTCCTTGTAGCACTGGCGGATACTGTG
GCA
ACCACCAGTACGGAGCTTGATGAAAACAGGGATAAGAACTACTCAGGAAGAGACACCTTAGATGAGT
GT
GGTTTGAGATACCTGTTAGCTATGCGCTTGCACACATGCCTGTTAACATCACTGCCTCCTTTATACCG
A
GTCCAGCTCCTTCACCAAGGAGTGTCTACCTGCCACTTTGCCTGGGCTTTTCATTCTGAAGCTGAGGAA
GAA
CTGATCAATATGATTCCAGCAATCCAAAGAGGGGACCCTCAGTGGTCTGAATTAAGAGCTATGGGAA
TA
GGCTGGTGGGTGAGGAATGTTAACACACTCCGAAGATGCATTGAAAAGGTTGCCAAAGCTGCTTTTCA
G
AGGAACAACGAGGCCTTAGATGCCGCTTTGTTCTACCTTTCCATGAAGAAGAAAGCGGTAGTGTGGGGT
CTG
TTCAGGTCACAACATGATGAAAAAATGACAACATTCTTCAGCCACAACTTTAATGAAGATAGATGGC
GG
AAAGCTGCTTTGAAAAACGCCTTTTCTTTACTTGGAAAGCAGCGCTTTGAGCAGTCTGCTGCTTTTTT
C
TTGTTAGCTGGTTCATTGAAAGATGCAATTGAGGTATGTCTTGAAAAAATGGAAGATATTCAACTAGCC
ATG
GTTATTGCCCGTTTATTTGAATCTGAATTTGAGACTTCATCTACTTACATCTCTATCTTGAATCAGA
AA
ATTTTGGGTTGTCAGAAAGACGGCACAGGATTCGATTGTAAAAGATTACATCCTGACCCTTTTCTGCG
T
AGTCTTGCCTATTGGGTAGTGAAAGATTATACCCGAGCCTTGGATACCTTACTGGAACAGACACCAAAG
GAA
GATGACGAGCAACAAGTCATCATCAAATCTTGTAACCCAGTGGTGTTCAGTTTTTACAACTACCTTC
GA
ACACATCCTTTACTTATTCGAAGAAATCTTGCTTCCCCTGAAGGAACTTTGGCAACTTTAGGTCTCAA
A
ACTGAGAAAAACATTGCTGATAAAATTAACCTCATAGAAAGAAAATTATTTTTTACCACCGCTAATGCT
CAT
TTTAAAGTTGGATGTCCTGTTTTAGCCCTTGAAGTACTTTCTAAAATTCCTAAAGTAACCAAAATAT
CC
TCCTTAACTGCAAAAAAAGATCAGCTTGACTCTGTTTCTGGAAGGATGGAGAACGGGCCATCAGAATC
A
AAACCAGTGAGCAGGAGTGATGGTGGTTCTGGGGCTGACTGGTCGGCTGTGACTTCCTCCCAGTTTGAC
TGG
AGTCAGCCAATGGTTACAGTTGACGAGGAGCCTCTTAGGCTCGATTGGGGTGACGATCATGACGGTG
CC
TTAGAAGAGGATGATGGCGGTGGCTTAGTAATGAAAACTACAGATGCCAAGAAGGCTGGCCAGGAGCA
G
AGTGCCTCAGACCCTCGTGCTTTGCTGACTCCTCAGGACGAGGAGTGTGCTGACGGCGATACTGAGGTC
GAT
GTGATTGCTGAACAACTCAAGTTCCGAGCTTGCTTGAAGATCCTTATGACTGAGTTAAGAACTTTGG
CT
ACAGGTTATGAAGTAGATGGAGGGAAGCTGAGATTTCAGCTCTATAACTGGCTTGAAAAGGAAATTGC
T
GCCTTGCATGAGATATGCAACCATGAATCAGTTATTAAAGAATATTCGAGCAAAGCGCATTCTACAGTA
GAG
ACTGAGCGTCTGGATCAGGAGGAAATGGTGGACAAGCCGGATATCGGTTCCTATGAGCGCCACCAAA
TA
GAACGACGACGGCTGCAGGCTAAAAGGGAGCATGCAGAAAGACGAAAGCTGTGGTTGCAGAAAAACCA
A
GATCTCCTGAGAGTATTTCTCAGTTACTGTAGCCTTCATGGAGCCCAGGGCGGTGGTCTGGCTTCAGTA
AGA
ATGGAACTCAAATTTTTGCTGCAAGAGTCACAGCAGGAAACTACAGTGAAGCAGCTCCAGTCCCCAC
TG
CCACTACCTACCACGTTGCCTCTGCTTTCAGCAAGTATCGCATCAACAAAAACAGTCATAGCTAACCC
T
GTATTGTATTTAAATAACCACATCCATGATATACTTTATACTATTGTGCAGATGAAAACACCACCTCAT
CCC
AGTGTTGAAGATGTGAAGGTGCACACACTTCATTCACTAGCAGCATCACTTTCTGCATCAATTTACC
AG
GCATTATGTGACAGTCATAGCTACAGCAGTCAGTCGGAAGGAAATCAGTTCACAGGAATGGCCTATCA
A
GGGCTTCTTCTAAGTGATCGACGACGCCTCAGGACAGAAAGCATCGAAGAGCATGCAACACCAAACTCA
GCT
CCTGCTCAGTGGCCTGGTGTGAGCTCACTCATTAATCTCTTGAGTTCTGCCCAAGATGAAGACCAGC
CA
AAATTGAATGTTCTGTTGTGTGAAGCTGTTGTTGCTGTTTACTTAAGTTTACTGATACATGCTCTTGC
C
ACAAATTCTTCCAATGAATTGTTTCGGCTTGCAGCCCACCCGTTAAATAATCGAATGTGGGCTGCTGTT
TTC
GGAGGGGGTGTAAAACTTGTTGTGAAGCCTCGGAGGCAATCAGAAAGTATCGCAGCACCTCCTGTGG
CC
TCTGAGGACATGGACAAGCACCGCAGGAGATTCAACATGAGGATGCTGGTCCCTGGGAGGCCTGTAAA
A
GATGCCACCCCACCCCCAGTGCCTGCAGAAAGACCATCTTACAAGGAAAAATTTATTCCCCCAGAACTT
AGT
ATGTGGGACTACTTTGTTGCAAAGCCGTTCCTCCCTTTGTCTGATAGTGGTGTCATATATGATTCTG
AT
GAAAGTGTACACAGTGATGATGAAGAGGATGATGCCTTTTTTTCAGACACACAAATACAGGAGCATCA
A
GATCCTAATTCTTATAGCTGGGCTCTTCTGCATTTGACAATGGTTAAGCTGGCGCTTCACAATATCAAG
AAT
TTTTTTCCTATTGCTGGGCTGGAATTCTCTGAGCTCCCTGTGACATCACCGCTAGGAATCGCTGTCA
TT
AAAAACTTGGAGAACTGGGAACAGATTCTGCAGGAGAAAATGGATCACTTTGAAGGCCCACCCCCTAA
C
TATGTCAACACATACCCAACTGACCTCTCAGTGGGAGCGGGGCCAGCTATTCTCCGAAATAAAGCAATG
TTA
GAGCCGGAAAACACTCCATTCAAATCCCGGGATTCGTCTGCACTTCCTGTCAAGCGACTCTGGCATT
TC
CTTGTCAAACAGGAAGTTCTTCAGGAGACATTTATTAGATACATTTTCACTAAGAAAAGAAAGCAGAG
T
GAGTCTGTAGAAGAACATGTGGAGCAGGTCAAACACAACTCCGTAGCAGAAGATTGCCACATCAAGGTC
GAA
GCTGATCTGGGCTACCCAGGAGGGAAGGCGAAGGTCATTCATAAGGAATCTGACATGATCATGGCAT
TC
TCTATTAATAAGGCAAACTGTAATGAAATTGTTTTGGCTTCAACACATGATGTTCAAGAACTCGATGT
C
ACTTCTCTACTGGCTTGTCAATCATATATATGGATCGGAGAAGAATATGACAGAGAGTCGAAAAGTTCA
GAT
GATATTGATTACCGTGGTTCCACTACAACCCTGTACCAGCCTGGTGCAGCCTCCCATTCCTCAAGCC
AG
CCACACCCACCTCCATCTCTGCCATGGCTAGGCAGTGGACAGACCAGCACTGGGGCTACTGTGCTCAT
G
AAAAGGAATCTACATAATGTTAAGAGAATGACATCACACCCCGTCCATCAGTACTATCTCACAGGTGCC
CAG
GACGGCAGTGTCCGCATGTTTGAGTGGACACGACCTCAGCAACTTGTCTGTTTCCGTCAAGCTGGCA
AT
GCAAGAGTTACTAGATTATATTTTAATTCACAAGGCAACAAGTGTGGTGTTGCAGACGGAGAGGGTTT
T
CTGAGTATCTGGCAAGTTAACCAAACTGCATCGAATCCTAAACCGTACATGAGTTGGCAGTGCCACAGT
AAG
GCCACAAGTGACTTTGCATTTATCACCTCTTCAAGCCTAGTTGCAACCTCTGGACATTCCAATGACA
AT
AGAAACGTATGCCTCTGGGACACATTGATATCACCTGGAAACAGCCTCATTCACGGTTTTACTTGTCA
T
GACCATGGTGCCACAGTACTCCAATATGCCCCCAAGCAACAACTCCTAATCTCTGGGGGTAGGAAAGGC
TAC
ATCTGCATTTTTGACATCAGACAGAGACAGCTAATACACACCTTCCAGGCACACGACTCGGCTATTA
AG
GCTTTGGCTCTGGATTCGTGTGAGGAGTACTTCACTACAGGCTCAGCAGAGGGCAATATAAAAGTATG
G
AGATTGACAGGCCATGGCCTGATTCATTCATTTAAGAGCGAGCATGCTAAGCAGTCCATATTTCGGAAC
ATT
GGCGCTGGAGTCATGCAGATTGCTATCAGCCAGGACAATCGGCTCTTCTCCTGTGGCGCAGACGGCA
CG
CTGAAAACCAGGGTTCTGCCCAGTGCTTTTAACATCCCTAATAGAATTCTTGACATTCTGTAG


Translation (3054 aa):
MHLHQVLTGAVNPGDNCYSVGSVGDVPFTAYGSGCDIVILASDFECVQIIPGAKHGNIQVSCVECSNQHG
R
VAASYGNAVCIFEPLGVNSHKRNSQLKCQWLKTGQFFLSSVTYNLAWDPQDNRLLTATDSIQLWAPPGG
D
ILEEEEDVDNRAPPVLNDWKCIWQC
KTSVSVHLMEWSPDGEYFATAGKDDCLLKVWYPMTGWKSSIIPQ
D
PHEVKRRRASTQFSFVYLAHPRAVTGFSWRKTSKYMP
RGSVCNVLLTSCHDGVCRLWAETLLPEDCLLG
E
QICETTTSSVASNLSSAGKHKDRIQHALE
TIHHLKNLRKGQRRSSVLVTHAELMPDKTATHEVHRHISH
H
ANALCHFHIAASINPTT
DIPNVLVGTAFNIDDINGGFVVHWLNNKEFHFTSSTEIFMHQLRKLSEKQLD
H
ESDDADREDEERSQDERERGLRMKLDH
ELSLDRESEAGTGSSEHEDGEREGSPRTHPRPSISMPLPTVL
L
DRKIETLLTEWNKNPDMLFTIHPVDGTFLVWHVKYLDEYNPGIFRQVQ
VSFSSRIPVAFPSGDANSLSK
N
IMMYACVNATKDSYNPSQQEMMSVDSPHGSQLHSPSHSTDMNILAPTVMMVSKHIDGSLNQWAVTFADK
S
AFTTVLTVSHKFRYCGHRFHLNDLACHSVLPLLLTSSHHNALLTPESDCQWDSDSKVNRLIDPVKHTKA
S
SKQPLRNAATRTFHDPNAIYSELILWRVDPIGPLSYTGGVSELARINSLHTSAFSNVAWLPTLIPSYCL

G
TYCNSASACFVASDGKNLRLYQAVVDARKLLDELSDPEASKLIGEVFNIVSQQSTARPGCIIELDAITD
Q
CGSNTQLLHVFQEDFIIGYKPHKEDMEKKEKESEIFFQPSQGYRPPPFSEKFFLVVIEKDGNNNSILHM
W
HLHLKSVQACL
AKAAEGISSDSLLSVPGQKNLDSSPETSSSMSSVPHSSSIANLQTASKLILSSRLVYS
Q
PLDLPEAVEVIRATPSA
GHLSSSSIYPVCLAPYLVVTTCSDNKVRFWKCCMETNSLGNTSDESETYHWR
R
WPLMNDEGEDNSSTVSIVGRPVAVSCSYTGRLAVAYKQPIHHNGFISKEFSMHVCIFECESTGGSEWVL
E
QTIHLDDLVKVGSVLDSRVSVDSNLFVYSKSDAFLSKDRYLIPNIKHLVHLDWVSKEDGSHILTVGVGA
N
IFMYGRLSGIVSDQTNSKDGVAVITLPLGGSIKQGVKSRWVLLRSIDLVSSVDGTPSLPVSLSWVRDGI
L
VVGMDCEMHVYAQWKHSVKFGNVDADSPVEETIQDHSALKSSMLARKSIVEGAAIPDDVFCSPTVVQDG
G
LFEAAHALSPTLPQYHPTQLLELMDLGKVRRAKAILSHLVKCIAGEVAIVRDPDAGEGTKRHLSRTISV
S
GSTAKDTVTIGKDGTRDYTEIDSIPPLPLHALLAADQDTSYRISEDSTKKPQSYEDHIESQSEDQYSEL
F
QVQEITTDDIDLEPEKRENKSKVINLSQYGPACFGQEHARVLSSHLMHSSLPGLTRLEQMFLVALADTV
A
TTSTELDENRDKNYS
GRDTLDECGLRYLLAMRLHTCLLTSLPPLYRVQLLHQGVSTCHFAWAFHSEAEE
E
LINMIPAIQRGDPQWSELRAMGIGWWVRNVNTLRRCIEK
VAKAAFQRNNEALDAALFYLSMKKKAVVWG
L
F
RSQHDEKMTTFFSHNFNEDRWRKAALKNAFSLLGKQRFEQSAAFFLLAGSLKDAIEVCLEKMEDIQLA
M
VIARLFESEFETSSTYISILNQKILGCQKDGTGFDCKRLHPDPFLRSLAYWVVKDYTRALDTLLEQTPK
E
DDEQQ
VIIKSCNPVVFSFYNYLRTHPLLIRRNLASPEGTLATLGLKTEKNIADKINLIERKLFFTTANA
H
FKVGCPVLALEVLSKIPKVTKISSLTAKKDQLDSVSGRMENGPSESKPVSRSDGGSGADWSAVTSSQFD
W
SQPMVTVDEEPLRLDWGDDHDGALEEDDGGGLVMKTTDAKKAGQEQSASDPRALLTPQDEECADGDTEV
D
VIAEQLKFRACLKILMTELRTLATGYEVDGGKLRFQLYNWLEKEIAALHEICNHESVIKEYSSKAHSTV
E
TERLDQEEMVDKPDIGSYERHQIERRRLQAKREHAERRKLWLQKNQDLLRVFLSYCSLHGAQGGGLASV
R
MELKFLLQESQQ
ETTVKQLQSPLPLPTTLPLLSASIASTKTVIANPVLYLNNHIHDILYTIVQMKTPPH
P
SVEDVK
VHTLHSLAASLSASIYQALCDSHSYSSQSEGNQFTGMAYQGLLLSDRRRLRTESIEEHATPNS
A
PAQWP
GVSSLINLLSSAQDEDQPKLNVLLCEAVVAVYLSLLIHALATNSSNELFRLAAHPLNNRMWAAV
F
GGGVKLVVKPRRQSESIA
APPVASEDMDKHRRRFNMRMLVPGRPVKDATPPPVPAERPSYKEKFIPPEL
S
MWDYFVAK
PFLPLSDSGVIYDSDESVHSDDEEDDAFFSDTQIQEHQDPNSYSWALLHLTMVKLALHNIK
N
FFPIAGLEFS
ELPVTSPLGIAVIKNLENWEQILQEKMDHFEGPPPNYVNTYPTDLSVGAGPAILRNKAM
L
EPENTPF
KSRDSSALPVKRLWHFLVKQEVLQETFIRYIFTKKRKQSESVEEHVEQVKHNSVAEDCHIKV
E
ADLGYPGGKAKVIHKESDMIMAFSINK
ANCNEIVLASTHDVQELDVTSLLACQSYIWIGEEYDRESKSS
D
DIDYRGSTTTLYQPGAASHSSSQPHPPPSLPWLGSGQTSTGATV
LMKRNLHNVKRMTSHPVHQYYLTGA
Q
DGSVRMFEWTRPQQLVCFRQAGNARVTRLYFNSQGNK
CGVADGEGFLSIWQVNQTASNPKPYMSWQCHS
K
ATSDFAFITSSSLVATSGHSNDN
RNVCLWDTLISPGNSLIHGFTCHDHGATVLQYAPKQQLLISGGRKG
Y
ICIFDIRQRQLIHTFQAHDSAIKALALDSCEEYFTTGSAEGNIK
VWRLTGHGLIHSFKSEHAKQSIFRN
I
GAGVMQIAISQDNRLFSCGADGTLKTRVLPSAFNIPNRILDIL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser