NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS5234.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
5234.1 Public Homo sapiens 6 ESR1 22 109 92 CCDS HistoryNCBI Gene:2099Re-query CCDS DB by CCDS ID:5234.1Re-query CCDS DB by GeneID:2099See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 5234.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000206249.7 ENSP00000206249.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000206249.7Link to Ensembl Protein Viewer:ENSP00000206249.3Re-query CCDS DB by Nucleotide ID:ENST00000206249Re-query CCDS DB by Protein ID:ENSP00000206249
Original member Current member EBI,WTSI ENST00000338799.9 ENSP00000342630.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000338799.9Link to Ensembl Protein Viewer:ENSP00000342630.5Re-query CCDS DB by Nucleotide ID:ENST00000338799Re-query CCDS DB by Protein ID:ENSP00000342630
Original member Current member EBI,WTSI ENST00000443427.5 ENSP00000387500.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000443427.5Link to Ensembl Protein Viewer:ENSP00000387500.1Re-query CCDS DB by Nucleotide ID:ENST00000443427Re-query CCDS DB by Protein ID:ENSP00000387500
Original member Current member EBI,WTSI ENST00000440973.5 ENSP00000405330.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000440973.5Link to Ensembl Protein Viewer:ENSP00000405330.1Re-query CCDS DB by Nucleotide ID:ENST00000440973Re-query CCDS DB by Protein ID:ENSP00000405330
Original member Current member NCBI NM_000125.3 NP_000116.2 Accepted alive Link to Nucleotide Sequence:NM_000125.3Link to Protein Sequence:NP_000116.2Re-query CCDS DB by Nucleotide ID:NM_000125Re-query CCDS DB by Protein ID:NP_000116Link to BLAST:NP_000116.2
Original member Current member NCBI NM_001122740.1 NP_001116212.1 Accepted alive Link to Nucleotide Sequence:NM_001122740.1Link to Protein Sequence:NP_001116212.1Re-query CCDS DB by Nucleotide ID:NM_001122740Re-query CCDS DB by Protein ID:NP_001116212Link to BLAST:NP_001116212.1
Original member Current member NCBI NM_001122741.1 NP_001116213.1 Accepted alive Link to Nucleotide Sequence:NM_001122741.1Link to Protein Sequence:NP_001116213.1Re-query CCDS DB by Nucleotide ID:NM_001122741Re-query CCDS DB by Protein ID:NP_001116213Link to BLAST:NP_001116213.1
Original member Current member NCBI NM_001122742.1 NP_001116214.1 Accepted alive Link to Nucleotide Sequence:NM_001122742.1Link to Protein Sequence:NP_001116214.1Re-query CCDS DB by Nucleotide ID:NM_001122742Re-query CCDS DB by Protein ID:NP_001116214Link to BLAST:NP_001116214.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000116.2 595 P03372-1 595 100% 0 0
NP_001116212.1 595 P03372-1 595 100% 0 0
NP_001116213.1 595 P03372-1 595 100% 0 0
NP_001116214.1 595 P03372-1 595 100% 0 0

Chromosomal Locations for CCDS 5234.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 6 (NC_000006.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 151807913 151808364 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 151842597 151842787 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 151880655 151880771 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 151944173 151944508 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 152011656 152011794 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 152060991 152061124 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 152094385 152094568 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 152098732 152098966 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1788 nt):
ATGACCATGACCCTCCACACCAAAGCATCTGGGATGGCCCTACTGCATCAGATCCAAGGGAACGAGCTGG
AG
CCCCTGAACCGTCCGCAGCTCAAGATCCCCCTGGAGCGGCCCCTGGGCGAGGTGTACCTGGACAGCAG
C
AAGCCCGCCGTGTACAACTACCCCGAGGGCGCCGCCTACGAGTTCAACGCCGCGGCCGCCGCCAACGCG
CAG
GTCTACGGTCAGACCGGCCTCCCCTACGGCCCCGGGTCTGAGGCTGCGGCGTTCGGCTCCAACGGCC
TG
GGGGGTTTCCCCCCACTCAACAGCGTGTCTCCGAGCCCGCTGATGCTACTGCACCCGCCGCCGCAGCT
G
TCGCCTTTCCTGCAGCCCCACGGCCAGCAGGTGCCCTACTACCTGGAGAACGAGCCCAGCGGCTACACG
GTG
CGCGAGGCCGGCCCGCCGGCATTCTACAGGCCAAATTCAGATAATCGACGCCAGGGTGGCAGAGAAA
GA
TTGGCCAGTACCAATGACAAGGGAAGTATGGCTATGGAATCTGCCAAGGAGACTCGCTACTGTGCAGT
G
TGCAATGACTATGCTTCAGGCTACCATTATGGAGTCTGGTCCTGTGAGGGCTGCAAGGCCTTCTTCAAG
AGA
AGTATTCAAGGACATAACGACTATATGTGTCCAGCCACCAACCAGTGCACCATTGATAAAAACAGGA
GG
AAGAGCTGCCAGGCCTGCCGGCTCCGTAAATGCTACGAAGTGGGAATGATGAAAGGTGGGATACGAAA
A
GACCGAAGAGGAGGGAGAATGTTGAAACACAAGCGCCAGAGAGATGATGGGGAGGGCAGGGGTGAAGTG
GGG
TCTGCTGGAGACATGAGAGCTGCCAACCTTTGGCCAAGCCCGCTCATGATCAAACGCTCTAAGAAGA
AC
AGCCTGGCCTTGTCCCTGACGGCCGACCAGATGGTCAGTGCCTTGTTGGATGCTGAGCCCCCGATACT
C
TATTCCGAGTATGATCCTACCAGACCCTTCAGTGAAGCTTCGATGATGGGCTTACTGACCAACCTGGCA
GAC
AGGGAGCTGGTTCACATGATCAACTGGGCGAAGAGGGTGCCAGGCTTTGTGGATTTGACCCTCCATG
AT
CAGGTCCACCTTCTAGAATGTGCCTGGCTAGAGATCCTGATGATTGGTCTCGTCTGGCGCTCCATGGA
G
CACCCAGGGAAGCTACTGTTTGCTCCTAACTTGCTCTTGGACAGGAACCAGGGAAAATGTGTAGAGGGC
ATG
GTGGAGATCTTCGACATGCTGCTGGCTACATCATCTCGGTTCCGCATGATGAATCTGCAGGGAGAGG
AG
TTTGTGTGCCTCAAATCTATTATTTTGCTTAATTCTGGAGTGTACACATTTCTGTCCAGCACCCTGAA
G
TCTCTGGAAGAGAAGGACCATATCCACCGAGTCCTGGACAAGATCACAGACACTTTGATCCACCTGATG
GCC
AAGGCAGGCCTGACCCTGCAGCAGCAGCACCAGCGGCTGGCCCAGCTCCTCCTCATCCTCTCCCACA
TC
AGGCACATGAGTAACAAAGGCATGGAGCATCTGTACAGCATGAAGTGCAAGAACGTGGTGCCCCTCTA
T
GACCTGCTGCTGGAGATGCTGGACGCCCACCGCCTACATGCGCCCACTAGCCGTGGAGGGGCATCCGTG
GAG
GAGACGGACCAAAGCCACTTGGCCACTGCGGGCTCTACTTCATCGCATTCCTTGCAAAAGTATTACA
TC
ACGGGGGAGGCAGAGGGTTTCCCTGCCACGGTCTGA


Translation (595 aa):
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANA
Q
VYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYT
V
REAGPPAFY
RPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFK
R
SIQ
GHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEV
G
SAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLA
D
RELVHMINWAKRVP
GFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
M
VEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNS
GVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLM
A
KAGLTLQQQHQRLAQLLLILSHIRHM
SNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASV
E
ETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser