NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS5177.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
5177.1 Public Homo sapiens 6 BCLAF1 22 109 92 CCDS HistoryNCBI Gene:9774Re-query CCDS DB by CCDS ID:5177.1Re-query CCDS DB by GeneID:9774See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 5177.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000531224.5 ENSP00000435210.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000531224.5Link to Ensembl Protein Viewer:ENSP00000435210.1Re-query CCDS DB by Nucleotide ID:ENST00000531224Re-query CCDS DB by Protein ID:ENSP00000435210
Original member NCBI NM_014739.2 NP_055554.1 Updated not alive Link to Nucleotide Sequence:NM_014739.2Link to Protein Sequence:NP_055554.1Re-query CCDS DB by Nucleotide ID:NM_014739Re-query CCDS DB by Protein ID:NP_055554
Current member NCBI NM_014739.3 NP_055554.1 Accepted alive Link to Nucleotide Sequence:NM_014739.3Link to Protein Sequence:NP_055554.1Re-query CCDS DB by Nucleotide ID:NM_014739Re-query CCDS DB by Protein ID:NP_055554Link to BLAST:NP_055554.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_055554.1 920 Q9NYF8-1 920 100% 0 0

Chromosomal Locations for CCDS 5177.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 6 (NC_000006.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 136261110 136261115 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 136261265 136261477 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 136267029 136267175 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 136268162 136268339 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 136269437 136269612 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 136271995 136272079 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 136273082 136273187 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 136275532 136275701 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 136275843 136276508 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 136277865 136278776 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 136279763 136279866 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2763 nt):
ATGGGTCGCTCCAATTCTAGATCACATTCTTCAAGGTCAAAGTCTAGATCACAGTCTAGTTCTCGATCAA
GA
TCAAGATCTCATTCTAGAAAGAAGCGATACAGTTCTAGGTCTCGTTCCAGAACATATTCAAGGTCTCG
T
AGTAGAGATCGTATGTATTCTAGAGATTATCGTCGCGATTACAGAAATAATAGAGGAATGAGACGACCT
TAT
GGGTACAGAGGAAGGGGTAGAGGGTATTATCAAGGAGGAGGAGGTAGATATCATCGAGGTGGTTATA
GA
CCTGTCTGGAATAGAAGGCACTCTAGGAGTCCTAGACGAGGTCGTTCACGTTCCAGGAGTCCAAAAAG
A
AGATCCGTTTCTTCTCAAAGATCCAGAAGCAGATCTCGCCGGTCATATAGATCTTCTAGGTCTCCAAGA
TCA
TCCTCTTCTCGTTCTTCATCCCCATATAGCAAATCTCCTGTTTCTAAAAGACGAGGGTCTCAGGAAA
AA
CAAACCAAAAAAGCTGAAGGGGAACCCCAAGAAGAGAGTCCGTTGAAAAGTAAATCACAGGAGGAACC
G
AAAGATACATTTGAACATGACCCATCTGAGTCTATCGATGAATTTAATAAGTCATCAGCCACATCCGGT
GAT
ATTTGGCCTGGCCTTTCAGCTTATGATAATAGTCCTAGATCACCCCATAGTCCTTCACCTATTGCTA
CA
CCACCTAGTCAGAGTTCATCTTGCTCTGATGCTCCCATGCTCAGTACAGTTCACTCTGCAAAAAATAC
T
CCTTCTCAGCATTCACATTCCATTCAGCATAGTCCTGAAAGGTCTGGGTCTGGTTCTGTTGGAAATGGA
TCT
AGTCGATACAGTCCTTCTCAGAATAGTCCAATTCATCACATCCCTTCACGAAGAAGTCCTGCAAAGA
CA
ATCGCACCACAGAATGCTCCAAGAGATGAGTCTAGGGGCCGTTCCTCGTTTTATCCTGATGGTGGAGA
T
CAGGAAACTGCAAAGACTGGGAAGTTCTTAAAAAGGTTCACAGATGAAGAGTCTAGAGTATTCCTGCTT
GAT
AGGGGTAATACCAGGGATAAAGAGGCTTCAAAAGAGAAAGGATCAGAGAAAGGGAGGGCAGAGGGAG
AA
TGGGAAGATCAGGAAGCTCTAGATTACTTCAGTGATAAAGAGTCTGGAAAACAAAAGTTTAATGATTC
A
GAAGGGGATGACACAGAGGAGACAGAGGATTATAGACAGTTCAGGAAGTCAGTCCTCGCAGATCAGGGT
AAA
AGTTTTGCTACTGCATCTCACCGGAATACTGAGGAGGAAGGACTCAAGTACAAGTCCAAAGTTTCAC
TG
AAAGGCAATAGAGAAAGTGATGGATTTAGAGAAGAAAAAAATTATAAACTTAAAGAGACTGGATATGT
A
GTGGAAAGGCCTAGCACTACAAAAGATAAGCACAAAGAAGAAGACAAAAATTCTGAAAGAATAACAGTA
AAG
AAAGAAACTCAGTCACCTGAGCAGGTAAAGTCTGAAAAGCTCAAAGACCTCTTTGATTACAGTCCCC
CT
CTACACAAGAATCTGGATGCACGAGAAAAGTCTACCTTCAGAGAGGAAAGCCCACTTAGGATCAAAAT
G
ATAGCGAGTGATTCTCACCGTCCTGAAGTCAAACTCAAAATGGCACCTGTTCCTCTTGATGATTCTAAC
AG
A
CCTGCTTCCTTGACTAAAGACAGGCTGCTTGCTAGTACACTTGTCCATTCTGTCAAGAAGGAGCAAG
AA
TTCCGATCCATCTTTGACCACATTAAGTTGCCACAGGCCAGCAAAAGCACTTCAGAGTCATTTATTCA
A
CACATTGTGTCCTTGGTTCATCATGTTAAAGAGCAATACTTCAAGTCAGCTGCAATGACCCTAAACGAG
CGG
TTCACTTCGTATCAGAAAGCCACTGAAGAACATAGTACTCGGCAAAAGAGCCCTGAAATACACAGGA
GA
ATTGACATCTCACCAAGTACCCTGAGGAAGCATACCCGTTTAGCAGGGGAAGAGAGAGTTTTTAAAGA
A
GAAAATCAAAAGGGAGATAAAAAATTAAGGTGTGACTCTGCTGACCTTCGGCATGACATTGATCGCCGT
AGA
AAAGAAAGAAGTAAAGAACGGGGAGATTCCAAGGGCTCCAGGGAATCCAGTGGATCAAGAAAGCAGG
AA
AAAACTCCAAAAGATTACAAGGAATACAAATCTTACAAAGATGACAGTAAACATAAAAGAGAGCAAGA
T
CATTCTCGATCTTCATCCTCTTCAGCATCACCTTCTTCTCCCAGTTCTCGAGAAGAAAAGGAGAGTAAG
AAG
GAAAGAGAAGAAGAATTTAAAACTCACCATGAAATGAAAGAATACTCAGGCTTTGCAGGAGTTAGCC
GA
CCACGAGGAACCTTTTTTCGAATTAGAGGCAGAGGAAGAGCCAGAGGAGTTTTTGCTGGGACAAATAC
T
GGTCCAAACAACTCAAATACTACTTTTCAAAAGAGACCGAAGGAAGAGGAATGGGATCCAGAATATACC
CCA
AAGAGCAAGAAGTACTTCTTGCATGACGACAGAGATGATGGTGTGGATTATTGGGCCAAAAGAGGAA
GA
GGTCGTGGTACTTTTCAACGTGGCAGAGGGCGCTTTAACTTCAAAAAATCAGGTAGCAGTCCTAAATG
G
ACTCATGACAAATACCAAGGGGATGGGATTGTTGAAGATGAAGAAGAGACCATGGAAAATAATGAAGAA
AAG
AAGGACAGACGCAAGGAAGAAAAGGAATAA


Translation (920 aa):
MGRSNSRSHSSRSKSRSQSSSRSRSRSHSRKKRYSSRSRSRTYSRSRSRDRMYSRDYRRDYRNNRGMRRP
Y
GYRGRGRGYYQGGGGRYHRGGYRPVWNRRHSRSPRRGRSRSRSPKRRSVSSQRSRSRSRRSYRSSRSPR
S
SSSRSSSPYSKSPVSKRRGSQEKQTKKAEGEPQEESPLKSKSQEEPKDTFEHDPSESIDEFNKSSATSG
D
IWPGLSAYDNSPRSPHSPSPIATPPSQSSSCSDAPMLSTVHSAKNTPSQHSHSIQHSPERSGSGSVGNG
S
SRYSPSQNSPIHHIPSRRSPAKTIAPQNAPRDESRGRSSFYPDGGDQETAKTGKFLK
RFTDEESRVFLL
D
RGNTRDKEASKEKGSEKGRAEGEWEDQEALDYFSDKESGKQKFNDSEGDDTEETEDYRQFRKSVLADQG
K
SFATASHRNTEEEGLKYKSKVSLKGNRESDGFREEKNYKLKETGYVVERPSTTKDKHKEEDKNSERITV
K
KETQSPEQVKSEKLKDLFDYSPPLHKNLDAREKSTFREESPLRIKMIASDSHRPEVKLKMAPVPLDDSN

R
PASLTKDRLLASTLVHSVKKEQEFRSIFDHIKLPQASKSTSESFIQHIVSLVHHVKEQYFKSAAMTLNE
R
FTSYQKATEEHSTRQKSPEIH
RRIDISPSTLRKHTRLAGEERVFKEENQKGDKKLRCDSADLRHDIDRR
R
KERSKERGDSKGSRESSGSRKQEKTPKDYKEYKSYKDD
SKHKREQDHSRSSSSSASPSSPSSREEKESK
K
EREEEFKTHHEMKEYSGFAGVSRPRGTF
FRIRGRGRARGVFAGTNTGPNNSNTTFQKRPKEEEWDPEYT
P
KSKKYFL
HDDRDDGVDYWAKRGRGRGTFQRGRGRFNFKKSGSSPKWTHDKYQGDGIVEDEEETMENNEE
K
KDRRKEEK
E



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser