NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS5137.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
5137.1 Public Homo sapiens 6 PTPRK 22 109 92 CCDS HistoryNCBI Gene:5796Re-query CCDS DB by CCDS ID:5137.1Re-query CCDS DB by GeneID:5796See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 5137.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000368226.8 ENSP00000357209.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000368226.8Link to Ensembl Protein Viewer:ENSP00000357209.4Re-query CCDS DB by Nucleotide ID:ENST00000368226Re-query CCDS DB by Protein ID:ENSP00000357209
Original member Current member NCBI NM_002844.3 NP_002835.2 Accepted alive Link to Nucleotide Sequence:NM_002844.3Link to Protein Sequence:NP_002835.2Re-query CCDS DB by Nucleotide ID:NM_002844Re-query CCDS DB by Protein ID:NP_002835Link to BLAST:NP_002835.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_002835.2 1440 Q15262-2 1440 100% 0 0

Chromosomal Locations for CCDS 5137.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 6 (NC_000006.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 127970227 127970280 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 127973022 127973157 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 127973664 127973827 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 127976657 127976782 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 127976923 127977054 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 127981116 127981289 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 127982831 127982980 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 127983242 127983377 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 127985721 127985875 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 127990769 127990885 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 127991294 127991391 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 127992673 127992709 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 127995462 127995538 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 127996901 127996988 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 127998720 127998904 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 128005084 128005244 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 128009130 128009268 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 128064758 128064794 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 128067519 128067792 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 128078813 128078918 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 128082437 128082638 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 128083715 128083824 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 128089690 128089992 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 128184432 128184725 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 128218922 128219096 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 128240035 128240150 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 128242521 128242602 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 128322039 128322310 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 128397566 128397688 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 128520259 128520358 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4323 nt):
ATGGATACGACTGCGGCGGCGGCGCTGCCTGCTTTTGTGGCGCTCTTGCTCCTCTCTCCTTGGCCTCTCC
TG
GGATCGGCCCAAGGCCAGTTCTCCGCAGGTGGCTGTACTTTTGATGATGGTCCAGGGGCCTGTGATTA
C
CACCAGGATCTGTATGATGACTTTGAATGGGTGCATGTTAGTGCTCAAGAGCCTCATTATCTACCACCC
GAG
ATGCCCCAAGGTTCCTATATGATAGTGGACTCTTCAGATCACGACCCTGGAGAAAAAGCCAGACTTC
AG
CTGCCTACAATGAAGGAGAACGACACTCACTGCATTGATTTCAGTTACCTATTATATAGCCAGAAAGG
A
CTGAATCCTGGCACTTTGAACATATTAGTTAGGGTGAATAAAGGACCTCTTGCCAATCCAATTTGGAAT
GTG
ACTGGATTCACGGGTAGAGATTGGCTTCGGGCTGAGCTAGCAGTGAGCACCTTTTGGCCCAATGAAT
AT
CAGGTAATATTTGAAGCTGAAGTCTCAGGAGGGAGAAGTGGTTATATTGCCATTGATGACATCCAAGT
A
CTGAGTTATCCTTGTGATAAATCTCCTCATTTCCTCCGTCTAGGGGATGTAGAGGTGAATGCAGGGCAA
AAC
GCTACATTTCAGTGCATTGCCACAGGGAGAGATGCTGTGCATAACAAGTTATGGCTCCAGAGACGAA
AT
GGAGAAGATATACCAGTAGCCCAGACTAAGAACATCAATCATAGAAGGTTTGCCGCTTCCTTCAGATT
G
CAAGAAGTGACAAAAACTGACCAGGATTTGTATCGCTGTGTAACTCAGTCAGAACGAGGTTCCGGTGTG
TCC
AATTTTGCTCAACTTATTGTGAGAGAACCGCCAAGACCCATTGCTCCTCCTCAGCTTCTTGGTGTTG
GG
CCTACATATTTGCTGATCCAACTAAATGCCAACTCGATCATTGGCGATGGTCCTATCATCCTGAAAGA
A
GTAGAGTACCGAATGACATCAGGATCCTGGACAGAAACCCATGCAGTCAATGCTCCAACTTACAAATTA
TGG
CATTTAGATCCAGATACCGAATATGAGATCCGAGTTCTACTTACAAGACCTGGTGAAGGTGGAACGG
GG
CTCCCAGGACCTCCACTAATCACCAGAACAAAATGTGCAGAACCTATGAGAACCCCAAAGACATTAAA
G
ATTGCTGAAATACAGGCAAGACGGATTGCTGTGGACTGGGAATCCTTGGGTTACAACATTACGCGTTGC
CAC
ACTTTTAATGTCACTATCTGCTACCATTACTTCCGTGGTCACAACGAGAGCAAGGCAGACTGTTTGG
AC
ATGGACCCCAAAGCCCCTCAGCATGTTGTGAACCATCTGCCACCTTATACAAATGTCAGCCTCAAGAT
G
ATCCTAACCAATCCAGAGGGAAGGAAGGAGAGTGAAGAGACAATTATTCAAACTGATGAAGATGTGCCT
GGT
CCCGTACCAGTAAAATCTCTTCAAGGAACATCCTTTGAAAATAAGATCTTCTTGAACTGGAAAGAAC
CT
TTGGATCCAAATGGAATCATCACTCAATATGAGATCAGCTATAGCAGTATAAGATCATTTGATCCTGC
A
GTTCCAGTGGCTGGACCTCCCCAGACTGTATCAAATTTATGGAACAGTACACACCATGTCTTTATGCAT
CTC
CACCCTGGAACCACGTACCAGTTTTTCATAAGAGCCAGCACGGTCAAAGGCTTTGGTCCAGCCACAG
CC
ATCAATGTCACCACCAATATCTCAGCTCCAACTTTACCTGACTATGAAGGAGTTGATGCCTCTCTCAA
T
GAAACTGCCACCACAATAACTGTATTGTTGAGACCAGCACAAGCCAAAGGTGCTCCTATCAGTGCTTAT
CAG
ATTGTTGTGGAAGAACTGCACCCACACCGAACCAAGAGAGAAGCCGGAGCCATGGAATGCTACCAGG
TT
CCTGTCACATACCAAAATGCCATGAGTGGGGGTGCACCGTATTACTTTGCTGCAGAACTCCCCCCGGG
A
AACCTACCTGAGCCTGCCCCGTTCACTGTGGGTGACAATCGGACCTACCAAGGCTTTTGGAACCCTCCT
TTG
GCTCCGCGCAAAGGATACAACATCTATTTCCAGGCGATGAGCAGTGTGGAGAAGGAAACTAAAACCC
AG
TGCGTACGCATTGCTACAAAAGCAGCAGCAACAGAAGAACCAGAAGTGATCCCAGATCCCGCCAAGCA
G
ACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCCTTCTCCTAGTT
GTC
ATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGG
AG
ATGACTCACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCC
T
CTTTCCATCACCTTCATGGACCAACATAACTTTAGTCCAAGATATGAGAACCACAGTGCTACAGCAGAG
TCC
AGTCGCCTTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGAATCCCCTTACCAGACAGGACAGC
TG
CATCCAGCCATCAGGGTAGCTGATTTACTGCAGCACATTAATCTCATGAAGACATCAGACAGCTATGG
G
TTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATGTAGCTAAAAAAGATCAA
AAT
AGAGCAAAAAACCGATATGGAAACATTATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAG
AG
GATGATCCTTCCTCAGATTATATTAATGCCAACTATATTGATGGCTACCAGAGACCAAGTCATTACAT
T
GCAACCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGCAAGAACAATCTGCT
TGC
ATTGTGATGGTTACAAATTTAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATA
CT
GAAGTTTATGGTGACTTCAAAGTAACGTGTGTAGAAATGGAACCACTTGCTGAATATGTAGTTAGGAC
A
TTCACCCTGGAAAGGAGGGGGTACAATGAAATCCGTGAAGTTAAACAGTTCCATTTCACGGGCTGGCCT
GAC
CATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCCGGCGAGTCAAGTTATCAAACCCTC
CC
AGTGCTGGCCCCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGATTGA
C
ATCATGCTAGACATGGCTGAAAGAGAGGGTGTTGTTGATATTTACAATTGTGTCAAAGCCTTAAGATCT
CGG
CGTATTAATATGGTCCAGACAGAGGAACAGTACATTTTTATTCATGATGCCATTTTAGAAGCCTGCT
TA
TGTGGAGAAACTGCCATACCTGTCTGTGAATTTAAAGCTGCATATTTTGATATGATTAGAATAGACTC
C
CAGACTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCCCTCGACTACAAGCT
GAA
GACTGCAGTATAGCGTGCCTGCCAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTG
AC
AGATGTCTGCCTTTTTTAATTACAATTGATGGGGAGAGCAGTAACTACATCAATGCTGCTCTTATGGA
C
AGCTACAGGCAACCAGCTGCTTTCATCGTCACACAATACCCTCTGCCAAACACTGTAAAAGACTTCTGG
AGA
TTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACGAAGTCGACTTGTCCCAGGGCTGCC
CT
CAGTACTGGCCAGAGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTTCAAT
G
GACTGTGATGTGATCAACCGGATTTTTAGGATATGCAATCTAACAAGACCACAGGAAGGTTATCTGATG
GTG
CAACAGTTTCAGTACCTAGGATGGGCTTCTCATCGAGAAGTGCCTGGATCCAAAAGGTCATTCTTGA
AA
CTGATACTTCAGGTGGAAAAGTGGCAGGAGGAATGCGAGGAAGGGGAAGGCCGGACGATTATCCACTG
C
CTAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAATGGTGAAACGGCAA
AAT
GTTGTCGATGTTTTCCATGCAGTAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGG
AG
CAATACCGTTTCTGCTATGATGTAGCTTTGGAGTACCTGGAATCATCTTAG


Translation (1440 aa):
MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSAGGCTFDDGPGACDYHQDLYDDFEWVHVSAQEPHYLPP
E
MPQ
GSYMIVDSSDHDPGEKARLQLPTMKENDTHCIDFSYLLYSQKGLNPGTLNILVRVNKGPLANPIWN
V
TGFTGRDWLRAELAVSTFWPNEYQ
VIFEAEVSGGRSGYIAIDDIQVLSYPCDKSPHFLRLGDVEVNAGQ
N
ATFQCIATGRDAVHNKLWLQ
RRNGEDIPVAQTKNINHRRFAASFRLQEVTKTDQDLYRCVTQSERGSGV
S
NFAQLIVR
EPPRPIAPPQLLGVGPTYLLIQLNANSIIGDGPIILKEVEYRMTSGSWTETHAVNAPTYKL
W
HLDPDTEYEIRVLLTRPGEGGTGLPGPPLITRTKCA
EPMRTPKTLKIAEIQARRIAVDWESLGYNITRC
H
TFNVTICYHYFRGHNESKADCLDMDPKAPQHVVNHLPPYTNVSLKMILTNPEGRKESEETIIQTDED
VP
G
PVPVKSLQGTSFENKIFLNWKEPLDPNGIITQYE
ISYSSIRSFDPAVPVAGPPQTVSNLWNSTHHVFMH
L
HPGTTYQFFIRASTVKGFGPATAINVTTNIS
APTLPDYEGVDASLNETATTITVLLRPAQAKGAPISAY
Q
IVVEELHPHRTKREAGAMECYQVPVTYQNAMSGGAPYYFAAELPPGNLPEPAPFTVGDNRTYQGFWNPP
L
APRKGYNIYFQAMSSVEK
ETKTQCVRIATKAAATEEPEVIPDPAKQTDRVVKIAGISAGILVFILLLLV
V
ILIVKK
SKLAKKRKDAMGNTRQEMTHMVNAMDRSYADQSTLHAEDPLSITFMDQHNFSPRYENHSATAE
S
SRLLDVPRYLCEGTESPYQTGQLHPAIRVADLLQHINLMKTSDSYGFKEEYE
SFFEGQSASWDVAKKDQ
N
RAKNRYGNIIA
YDHSRVILQPVEDDPSSDYINANYIDGYQRPSHYIATQGPVHETVYDFWRMIWQEQSA
C
IVMVTNLVEVGR
VKCYKYWPDDTEVYGDFKVTCVEMEPLAEYVVRTFTLERRGYNEIREVKQFHFTGWP
D
HGVPYHATGLLSFIRRVKLSNPPSAGPIVVHC
SAGAGRTGCYIVIDIMLDMAEREGVVDIYNCVKALRS
R
RINMVQTE
EQYIFIHDAILEACLCGETAIPVCEFKAAYFDMIRIDSQTNSSHLKDEFQTLNSVTPRLQA
E
DCSIACLPRNHDKNRFMDMLPPDRCLPFLITIDGESSNYINAALMD
SYRQPAAFIVTQYPLPNTVKDFW
R
LVYDYGCTSIVMLNEVDLSQ
GCPQYWPEEGMLRYGPIQVECMSCSMDCDVINRIFRICNLTRPQEGYLM
V
QQFQYLGWASHREVPGSKRSFLKLILQVEKWQEECEEGEGRTIIHC
LNGGGRSGMFCAIGIVVEMVKRQ
N
VVDVFHAVKTLRNSKPNMVEAP
EQYRFCYDVALEYLESS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser