NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS51333.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
51333.1 Public Mus musculus 4 Hspg2 21 106 86 CCDS HistoryNCBI Gene:15530Re-query CCDS DB by CCDS ID:51333.1Re-query CCDS DB by GeneID:15530See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 51333.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000171332 ENSMUSP00000131316 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000171332Link to Ensembl Protein Viewer:ENSMUSP00000131316Re-query CCDS DB by Nucleotide ID:ENSMUST00000171332Re-query CCDS DB by Protein ID:ENSMUSP00000131316
Original member Current member NCBI NM_008305.3 NP_032331.2 Accepted alive Link to Nucleotide Sequence:NM_008305.3Link to Protein Sequence:NP_032331.2Re-query CCDS DB by Nucleotide ID:NM_008305Re-query CCDS DB by Protein ID:NP_032331Link to BLAST:NP_032331.2

Chromosomal Locations for CCDS 51333.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 137468862 137468924 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137501059 137501194 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137502276 137502320 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137507801 137507910 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137508010 137508068 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137508304 137508464 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137510542 137510670 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137510907 137511161 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137511246 137511365 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137511842 137511973 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137512103 137512247 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137512339 137512490 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137512630 137512776 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137514611 137514774 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137515294 137515473 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137515558 137515754 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137515860 137516007 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137516776 137516903 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137517201 137517287 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137517365 137517423 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137517583 137517650 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137518383 137518523 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137518633 137518809 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137518916 137519095 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137519186 137519304 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137519666 137519777 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137519882 137519995 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137520087 137520214 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137520510 137520596 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137521443 137521492 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137521739 137521833 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137522033 137522173 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137522459 137522650 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137528805 137528897 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137529163 137529243 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137529343 137529573 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137531624 137531737 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137533432 137533559 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137533665 137533751 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137535124 137535182 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137535341 137535505 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137535620 137535730 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137538185 137538285 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137538371 137538551 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137539102 137539227 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137539301 137539453 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137539537 137539679 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137539971 137540106 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137540195 137540349 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137540659 137540809 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137541408 137541553 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137541641 137541776 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137542231 137542382 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137542512 137542647 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137542739 137542890 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137543524 137543653 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137543842 137543993 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137544365 137544503 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137544588 137544739 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137545278 137545413 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137545519 137545670 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137546555 137546693 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137548021 137548172 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137548346 137548502 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137549538 137549677 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137549979 137550120 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137550341 137550492 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137550805 137550946 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137551064 137551204 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137551792 137551926 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137552095 137552276 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137552779 137552974 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137553175 137553354 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137553596 137553856 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137555089 137555293 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137556640 137556737 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137557174 137557440 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137558813 137558922 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137559090 137559237 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137559314 137559430 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137560413 137560515 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137561680 137561824 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137561907 137562006 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137562162 137562271 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137562382 137562490 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137563991 137564089 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137564345 137564566 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137564770 137565014 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137565329 137565500 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137565617 137565739 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137565834 137565890 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137568127 137568202 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137568301 137568379 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137568535 137568602 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137568762 137568845 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137569261 137569364 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137569492 137569664 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (13152 nt):
ATGGGGCAGCGGGCAGTGGGCTCGTTGCTGCTGGGGCTGCTGCTGCACGCGCGGCTGCTAGCGGTGACGC
AT
GGGCTGAGGGCCTACGATGGCCTTTCCCTCCCTGAGGACACAGAGACTGTCACAGCGAGCCGGTATGG
C
TGGACCTACTCATACCTCTCTGATGATGAGGACCTGCTGGCAGATGATGCATCAGGAGATGGCCTCGGC
AGC
GGAGACGTGGGCAGCGGGGACTTCCAGATGGTCTATTTCCGGGCTCTGGTAAATTTTACTCGGTCCA
TT
GAGTACAGCCCCCAGCTGGAGGATGCAAGTGCCAAGGAGTTCCGAGAGGTGTCGGAGGCTGTGGTAGA
A
AAGCTGGAGCCCGAATACAGGAAGATCCCCGGAGACCAGATTGTCAGTGTGGTGTTCATCAAGGAACTG
GAT
GGCTGGGTCTTTGTTGAGCTGGATGTTGGCTCCGAAGGGAATGCGGACGGATCTCAGATTCAAGAGG
TG
CTGCATACAGTGGTCTCCAGTGGCTCCATCGGCCCCTATGTCACCTCCCCCTGGGGGTTCAAGTTCCG
A
CGCCTGGGCACAGTGCCCCAGTTCCCAAGAGTCTGCACGGAGACGGAGTTTGCTTGCCACAGCTATAAT
GAG
TGTGTGGCTCTGGAGTATCGCTGTGACCGGAGGCCTGACTGCAGGGACATGTCTGATGAACTCAACT
GT
GAGGAACCAGTCCCCGAGCTCAGCTCCTCGACACCTGCTGTGGGGAAGGTGTCACCTTTACCACTCTG
G
CCAGAAGCAGCCACAACACCTCCACCGCCAGTCACGCATGGACCTCAGTTTCTGTTACCCAGTGTTCCT
GGG
CCCTCAGCCTGTGGGCCCCAGGAGGCCTCGTGCCACAGCGGACACTGCATCCCCCGAGACTACCTCT
GT
GATGGACAGGAAGACTGCAGGGATGGCAGTGACGAACTGGGCTGTGCGTCCCCTCCACCCTGTGAGCC
T
AACGAGTTCGCCTGTGAAAATGGGCACTGTGCTCTCAAGTTGTGGCGCTGTGACGGTGACTTTGATTGT
GAG
GACCGGACAGATGAGGCCAATTGTTCTGTCAAGCAGCCTGGAGAAGTATGTGGGCCCACGCACTTCC
AG
TGTGTCTCCACCAACCGCTGCATCCCAGCCAGCTTCCACTGTGACGAGGAATCCGACTGTCCCGACCG
C
AGTGATGAGTTTGGCTGCATGCCTCCCCAGGTAGTGACGCCTCCACAGCAGTCCATCCAGGCTTCCCGG
GGC
CAGACAGTGACTTTCACCTGCGTAGCCACTGGTGTCCCCACACCCATCATCAACTGGAGGCTCAACT
GG
GGCCACATCCCTGCTCATCCCAGGGTGACAATGACCAGCGAGGGTGGGCGTGGCACGCTGATCATCCG
T
GACGTGAAGGAGGCAGACCAGGGCGCATACACCTGTGAGGCCATGAACTCGCGTGGCATGGTGTTCGGC
ATT
CCAGACGGCGTGCTGGAGCTTGTCCCGCAGCGAGGGCCCTGCCCTGACGGGCACTTCTACCTGGAAG
AC
AGTGCCTCCTGCCTGCCCTGCTTCTGCTTTGGTGTGACCAACGTGTGCCAGAGCAGCCTGCGCTTCCG
G
GACCAGATCCGACTGAGCTTTGACCAGCCCAATGACTTCAAGGGTGTGAATGTGACGATGCCCTCCCAG
CCC
GGCGTGCCACCCCTCTCCTCCACCCAGCTGCAGATCGACCCCGCCCTGCAGGAGTTCCAGCTGGTCG
AC
CTGTCTCGCCGCTTCCTTGTCCACGATGCTTTCTGGGCCCTACCCAAGCAGTTTCTGGGCAACAAGGT
G
GACTCCTATGGAGGCTTCCTGCGCTACAAGGTGCGCTATGAACTGGCACGAGGCATGCTGGAGCCGGTG
CAG
AAACCAGATGTGATCCTCGTGGGTGCGGGGTACCGCCTACACTCTCGAGGCCACACCCCCACCCATC
CT
GGAACTCTGAACCAGCGTCAGGTCCAGCTCTCAGAGGAACACTGGGTCCACGAGTCTGGCCGGCCTGT
C
CAGCGGGCTGAGATGCTGCAGGCCCTGGCGAGCCTGGAGGCTGTCCTGCTACAGACAGTGTATAACACC
AAG
ATGGCCAGTGTGGGGCTGAGTGACATTGTCATGGACACCACTGTCACCCATACCACCATCCATGGCC
GG
GCTCACAGTGTAGAGGAGTGCAGATGCCCCATTGGCTATTCTGGTTTGTCTTGCGAGAGCTGCGATGC
C
CACTTCACCCGCGTGCCTGGCGGGCCCTACCTGGGTACTTGCTCTGGCTGTAATTGCAATGGCCATGCC
AGC
TCCTGTGACCCTGTCTACGGCCACTGCCTGAATTGCCAGCACAACACAGAAGGACCTCAGTGTGACA
AG
TGTAAGCCTGGCTTCTTTGGAGATGCCACAAAGGCCACAGCCACTGCCTGCCGGCCCTGTCCCTGCCC
A
TACATCGACGCTTCCCGAAGGTTCTCAGACACTTGCTTCCTGGACACGGACGGCCAAGCCACTTGCGAC
GCT
TGTGCCCCAGGTTACACAGGCCGCCGCTGTGAGAGCTGTGCCCCTGGATATGAAGGCAACCCCATCC
AG
CCTGGCGGGAAGTGCAGGCCCACCACCCAGGAAATTGTGCGCTGTGATGAGCGAGGGAGCCTGGGCAC
C
TCAGGGGAGACTTGCCGCTGTAAGAACAATGTAGTGGGGCGCTTGTGCAACGAGTGCTCGGACGGCTCG
TTC
CACCTGAGCAAGCAAAACCCGGACGGCTGCCTCAAGTGCTTCTGCATGGGAGTTAGTCGCCAGTGCA
GC
AGCTCCTCCTGGAGCCGCGCCCAGGTGCTCGGGGCCTCGGAACAGCCCTCTCAGTTCAGCCTGAGCAA
C
GCCGCCGGCACCCACACCACCAGCGAGGGGGTCTCGTCCCCTGCACCCGGGGAGCTGTCGTTCTCTTCC
TTC
CACAACCTCCTGTCTGAACCCTACTTCTGGAGTCTTCCCGCCAGCTTCCGAGGGGACAAGGTGACGT
CC
TACGGCGGAGAGCTGCGCTTCACTGTGACGCAGAGGCCCCGGCCCAGTTCTGCGCCCCTGCACAGACA
G
CCCCTGGTGGTGTTGCAGGGCAACAACATTGTGTTGGAGCATCATGCCTCGAGGGATCCCAGCCCTGGC
CAG
CCCAGCAACTTCATAGTGCCCTTCCAAGAGCAAGCGTGGCAGCGGCCTGATGGGCAGCCGGCCACAC
GG
GAGCACCTGCTGATGGCCCTGGCAGGCATTGATGCCCTCCTCATCCAAGCATCTTACACGCAGCAACC
G
GCTGAGAGCAGGGTCTCTGGTATCAGCATGGATGTGGCTGTGCCAGAGAACACCGGCCAGGACTCAGCC
CGG
GAAGTAGAGCAGTGTACCTGCCCCCCTGGTTACCGCGGCCCTTCCTGCCAGGACTGTGACACAGGTT
AC
ACACGTGTGCCCAGCGGGCTCTACCTGGGCACCTGTGAGCGCTGTAACTGCCATGGCCACTCAGAGAC
C
TGTGAGCCTGAGACAGGGGCGTGCCAGAGCTGCCAGCACCACACGGAGGGTGCTAGCTGTGAACAGTGC
CAG
CCAGGGTACTATGGGGATGCCCAACGGGGCACACCACAGGACTGCCAGCCCTGCCCATGCTACGGAG
CC
CCTGCTGCTGGCCAAGCTGCCCACACTTGTTTCCTGGACACAGATGGCCACCCCACTTGTGACTCATG
C
TCACCAGGACACAGCGGGCGTCACTGTGAGAGGTGTGCCCCAGGTTACTATGGCAACCCCAGCCAGGGC
CAG
CCCTGCCACAGAGATGGTCAGGTGCCAGAGGTGCTGGGCTGTGGCTGTGACCCCCATGGCAGCATCA
GC
AGCCAGTGTGACGCCGCTGGTCAGTGCCAGTGCAAGGCCCAGGTGGAGGGCCGTACTTGCAGTCACTG
C
CGACCTCACCACTTCCACCTGAGTGCCAGCAACCCGGAAGGCTGCCTGCCCTGTTTCTGCATGGGTGTC
ACC
CAGCAGTGTGCCAGCTCCTCTTACTCCCGCCAGCTGATCTCTACCCACTTTGCTCCTGGGGACTTCC
AA
GGCTTTGCTCTGGTGAACCCTCAACGCAACAGCCAACTGACAGGGGGCTTCACCGTGGAACCAGTGCA
C
GATGGGGCCCGCCTCTCTTTCAGCAACTTTGCCCACCTCGGCCAAGAGTCCTTCTACTGGCAGCTGCCA
GAA
ATATACCAAGGAGACAAGGTGGCAGCCTATGGCGGGAAGCTGCGGTACACCCTCTCCTACACAGCCG
GG
CCACAGGGCAGCCCACTCTTGGACCCTGATATCCAGATTACGGGCAATAACATCATGTTGGTGGCTTC
C
CAGCCAGCACTACAGGGCCCAGAGAGGAGGAGCTATGAGATCATCTTCCGAGAGGAGTTCTGGCGGCGG
CCA
GATGGACAGCCTGCGACCCGAGAGCATTTGCTCATGGCCCTGGCAGATCTGGATGAACTTCTGGTGC
GG
GCCACATTCTCCTCTGTGCCACGGGCAGCCAGTATCAGTGCCGTGAGCCTAGAAGTGGCCCAGCCAGG
G
CCCTCCAGTGGACCCCGAGCCCTCGAGGTGGAAGAGTGTCGCTGCCCCCCAGGCTATGTTGGCTTGTCC
TGC
CAGGACTGTGCCCCGGGCTACACTCGCACTGGGAGCGGACTGTACCTTGGTCAGTGCGAGTTGTGTG
AA
TGCAACGGCCACTCCGACTTGTGTCACCCGGAGACTGGAGCCTGCTCGCGATGTCAGCACAACACAGC
C
GGTGAGTTCTGTGAGCTGTGTGCAACTGGTTACTATGGAGATGCCACGGCTGGGACGCCTGAGGATTGC
CAG
CCCTGTGCCTGCCCGCTGACCAACCCAGAGAACATGTTCTCCCGCACCTGTGAGAGCCTTGGAGCTG
GA
GGGTACCGCTGCACCGCCTGTGAACCTGGCTACACTGGGCAGTACTGTGAGCAGTGTGCCCCAGGCTA
T
GAGGGTGACCCCAATGTACAAGGAGGCCGGTGCCAGCCACTGACAAAAGAGTCCCTGGAGGTTCAGATC
CAT
CCATCTCGGAGCGTGGTTCCCCAAGGCGGCCCACACTCCCTGAGGTGCCAGGTCAGTGGGAGCCCAC
CA
CACTACTTCTACTGGTCCCGTGAAGATGGACGGCCCTTGCCCAGCAGCGCTCAACAGCGGCATCAAGG
C
TCTGAGCTCCACTTCCCTAGCGTGCAGCCCTCCGACGCCGGCGTCTACATCTGTACCTGCCGAAACCTG
ATT
CACACGAGCAACAGCAGGGCTGAGCTACTGGTCGCTGAGGCTCCCAGCAAGCCCATCACAGTGACAG
TG
GAGGAGCAGCGGAGCCAGAGTGTGCGGCCCGGAGCTGACGTCACTTTCATCTGTACGGCCAAGAGCAA
A
TCCCCAGCCTACACCCTGGTATGGACCCGTCTGCACAATGGGAAGCTGCCGTCCCGTGCTATGGACTTC
AAC
GGCATCCTGACCATTCGCAATGTGCAGCCAAGTGACGCGGGCACCTACGTGTGTACTGGCTCCAACA
TG
TTCGCTATGGACCAGGGCACAGCCACACTGCATGTTCAGGTCTCAGGTACCTCCACTGCCCCTGTGGC
C
TCCATACACCCTCCACAGCTCACCGTGCAGCCGGGACAACAGGCTGAGTTCCGCTGTAGCGCCACGGGG
AAC
CCCACCCCCATGCTGGAATGGATAGGGGGTCCTAGCGGCCAGCTTCCTGCGAAGGCTCAGATCCACA
AC
GGCATCCTGCGCTTGCCAGCCATTGAACCCTCGGATCAGGGCCAGTACCTGTGCCGTGCCCTCAGCAG
C
GCTGGGCAGCATGTGGCCAGGGCTATGCTTCAGGTGCACGGGGGCAGTGGACCCAGGGTCCAGGTTAGC
CCC
GAGAGGACCCAGGTGCATGAAGGCCGCACAGTGAGGCTGTACTGCAGGGCAGCAGGGGTACCCAGTG
CC
AGCATCACCTGGAGGAAGGAGGGAGGCAGCCTGCCCCCACAGGCCCGGTCAGAGAACACAGACATCCC
C
ACACTGCTCATCCCAGCCATTACAGCTGCTGACGCTGGCTTCTACCTCTGTGTGGCCACCAGCCCCACA
GGC
ACCGCCCAGGCACGCATTCAGGTGGTCGTCCTCTCAGCTTCGGGTGCCAACTCAGTGCCAGTCAGGA
TA
GAATCCTCGTCGCCATCCGTGACTGAAGGACAGACGCTTGACCTTAACTGTGCGGTGATGGGGTTGAC
C
TACACCCAGGTCACATGGTACAAGCGAGGGGGCAGCCTGCCTCCCCATGCCCAGGTCCACGGCTCCCGG
CTG
CGGCTCCCGCAGGTCTCACCGGCAGACTCCGGAGACTATGTGTGCCGAGTGGAGAGTGACGTGGGCC
CT
AAGGAGGCTTCCATTGTTGTCTCTGTCCTTCACAGCCCCCATTCAGGCCCCAGCTACACCCCAGCCAC
C
AGCATCACCCCACCCATCCGCATTGAATCCTCGTCCTCCCACGTGGCCGAAGGACAAACCCTGGATCTG
AAC
TGCGTGGTGCCTGGGCAGGCACAGGTGACGTGGCGCAAACGTGGAGGCAGCCTTCCTGCCCGGCACC
AG
ACCCATGGTTCCCTGCTGAGACTACACCAGGTGTCCCCTGCCGACTCAGGCGAGTATGTGTGCCATGT
C
GTCCTGGGCTCTGAGCACACAGAAACCTCTGTCCTGGTCACCATCGAACCTGCCGAGTCTATCCCTGCC
CCT
GGGCCTGCCCCTCCTGTCAGAATTGAGGCCTCATCCTCCACTGTGACTGAGGGTCACATGCTGGATC
TC
AACTGTGTGGTGGCAGGACAGGCCCACGCGCAGGTCACATGGTACAAGCGTGGGGGCAGCCTGCCAGC
C
CGGCATCAGGTCCGCGGCTCCCGCCTGTACATCTTACAGGCTTCCCCAGCAGATGCTGGAGAATATGTG
TGC
AGGGCAGGCAATGGGCAGGAAGCCACCATCACAGTCACGGTCACACGCAACCATGGGGCCAACCTTG
CC
TACCCCCCGGGTAGCACGTCACCCATCCGCATTGAGTCCTCTTCCTCTCACGTGGCTGAGGGGCAGAC
C
CTGGATCTAAATTGTGTGGTGCAAGGACAGGCCCATGCCCAAGTCACATGGCACAAGAGAGGAGGCAGC
CTG
CCTGCCCGGCACCAGACCCATGGCTCCCTGCTGCGGCTGCACCAGGTGTCTCCTGTGGACTCAGGAG
AA
TATGTGTGCCGAGTGGAGGGAGGGGCCGTGCCTCTGGAGAGCTCTGTCCTGGTGACCATTGAGCCTGC
A
GGCACTGCACCTGGGGTCATCCCTCCAGTCCGAATCGAATCATCTTCCTCCCACGTGTCGGAGGGGCAG
AGT
CTGGATCTGAATTGCCTTGTTTCTGGGCAGACTCACCCCCAGATCTCCTGGCACAAGCGTGGGGGCA
GC
CTCCCTGCCCGGCATCAGGTACATGGCTCAAGACTGAGACTTCTCCAGGTGACCCCAACTGACTCTGG
A
GAGTATGTATGCCGAGTCGTCAGTGGCTCGGGCACCCAAGAAGCTTCTATCCTTGTCACCATCCAGCAG
ACC
CTCAGCCCCTCCCACTCCCAGAGCGTGGTGCACCCAGTGCGCATTGAATCCTCGTCACCTTCGCTGG
CC
AATGGGCATACTCTGGACCTGAACTGCCTGGTTGCCAGCCTCACCCCCCACACCATCACCTGGTACAA
G
CGCGGAGGCAGCTTACCCAGCCGGCATCAGATTGTGGGCTCCCGCCTCCGGATCCCTCAAGTGACCCCA
GCA
GACTCCGGAGAGTATGTGTGTCACGTCAGTAACGGCGCTGGCTCCCAGGAGACCTCTCTCATCGTTA
CC
ATCGAGAGCAGAGGGCCATCCCATGTGCCCAGTGTCTCCCCACCAATGAGAATTGAGACCTCATCTCC
C
ACAGTGACGGAAGGACAGACCCTGGATCTGAACTGTGTGGTGGTCGGGCGGCCTCAGGCTACCATCACA
TGG
TACAAGCGTGGGGGCAGCCTGCCATTCAGACACCAGGCCCATGGCTCTCGTCTACGGCTACACCACA
TG
TCGGTGGCTGACTCCGGCGAGTATGTGTGCCGAGCCAACAACAACATTGATGCCCAGGAGACCTCCAT
C
ATGATCTCGGTCTCCCCTAGCACCAACAGCCCCCCTGCCCCCGCCAGCCCTGCACCCATCAGAATAGAG
TCT
TCCTCTTCACGTGTGGCCGAAGGACAGACCCTGGATCTGAACTGTGTGGTCCCTGGGCACGCCCATG
CC
CAGGTCACATGGCACAAGCGAGGGGGTAGCCTGCCCACTCATCATCAGACGCACGGCTCAAGGCTGCG
G
CTATACCAGGTGTCCTCAGCCGACTCGGGCGAATATGTGTGCAGCGTTCTGAGCAGCTCTGGCCCTCTG
GAG
GCTTCCGTCCTGGTCTCGATTACACCAGCTGCCGCTAATGTCCACATCCCTGGTGAGGTTCCTTTCC
CG
CCCATCCGCATCGAGACTTCCTCCTCCCGAGTGGCTGAGGGGCAGACCCTGGATCTAAGCTGTGTGGT
T
CCTGGGCAGGCCCATGCCCAGGTCACATGGCACAAACGTGGAGGCAGCCTGCCCGCTGGGCACCAGGTC
CAT
GGCCACATGCTGAGACTGAACCGTGTGTCCCCGGCGGACTCTGGCGAGTACTCATGCCAAGTGACGG
GC
AGCTCAGGTACCCTGGAGGCTTCTGTCCTGGTCACCATCGAGGCCTCTGAACCCAGCCCTATCCCTGC
C
CCGGGCCTGGCCCAGCCTGTCTACATAGAGTCCTCCTCCTCCCATTTGACTGAAGGGCAGACTGTAGAT
CTG
AAGTGCGTGGTACCAGGGCAAGCCCATGCCCAGGTCACATGGCACAAACGAGGGAGCAGCCTGCCTG
CC
CGACACCAGACTCATGGCTCCCTGCTGAGGCTCTACCAGCTCTCCCCTGCTGACTCCGGCGAGTACGT
G
TGCCAAGTGGCTGGTAGCTCCCACCCTGAGCATGAGGCTTCCTTCAAGCTCACAGTACCCTCCAGCCAA
AAC
TCTTCCTTCCGCCTCAGAAGCCCCGTCATCTCCATTGAACCACCCAGCAGCACGGTACAGCAGGGCC
AA
GATGCCAGTTTCAAGTGCCTTATTCACGAGGGAGCAACGCCCATCAAGGTTGAGTGGAAGATTCGGGA
C
CAAGAGCTGGAGGACAACGTCCACATCAGCCCCAACGGCTCCATCATTACCATCGTGGGCACCCGGCCC
AGC
AACCATGGAGCCTACCGCTGCGTGGCTTCCAATGTCTATGGTATGGCCCAGAGTGTCGTCAATCTCA
GC
GTGCATGGGCCCCCTACGGTGTCTGTGCTCCCCGAGGGCCCTGTGCATGTGAAGATGGGGAAGGACAT
C
ACCCTGGAGTGCATCAGTTCTGGAGAACCGCGCTCTTCCCCTCGTTGGACCCGACTCGGCATCCCTGTC
AAG
TTGGAGCCGCGGATGTTTGGGCTCATGAATAGCCATGCGATGCTGAAGATCGCATCCGTGAAACCAT
CA
GACGCAGGCACCTACGTGTGCCAAGCCCAGAACGCCCTAGGCACAGCACAGAAGCAAGTGGAGCTGAT
C
GTGGACACTGGCACCGTGGCCCCGGGGGCTCCCCAGGTCCAAGTTGAAGAATCTGAGCTGACCTTGGAG
GCT
GGCCACACGGCCACTTTACACTGCTCAGCCACGGGCAACCCTCCACCCACCATCCACTGGTCCAAGC
TG
CGCGCCCCACTGCCCTGGCAGCACCGGATAGAAGGCAACACACTGGTCATTCCCCGGGTGGCCCAGCA
G
GACTCAGGACAGTACATCTGTAACGCCACCAACTCTGCTGGGCACACTGAAGCCACCGTTGTCCTGCAT
GTG
GAGAGTCCTCCATATGCCACCATAATTCCAGAACATACCTCGGCGCAGCCAGGGAACCTGGTTCAGC
TG
CAGTGCCTGGCTCACGGCACGCCCCCGCTCACCTACCAGTGGAGCCTTGTGGGCGGCGTCCTCCCCGA
G
AAGGCGGTTGCCAGGAACCAGGTGCTGCGCCTGGAGCCCACAGTCCCCGAAGACTCTGGCCGCTACCGC
TGC
CAGGTCTCCAACAGGGTGGGCTCCGCGGAGGCCTTTGCTCAAGTCCTGGTCCAAGGCTCCTCTAGCA
AT
CTCCCTGACACTTCCATCCCAGGAGGATCCACACCCACTGTGCAAGTCACTCCTCAGCTAGAGACCCG
G
AACATAGGGGCCAGCGTTGAGTTCCACTGTGCTGTGCCCAATGAGCGTGGCACCCACCTTCGCTGGCTC
AAG
GAGGGCGGTCAGCTGCCTCCTGGACACAGTGTACAAGATGGAGTCCTCAGAATCCAGAACTTAGACC
AG
AGCTGCCAAGGGACATATGTCTGTCAGGCCCATGGGCCTTGGGGACAAGCCCAGGCCACTGCCCAGCT
G
ATCGTTCAAGCCTTGCCCTCCGTGCTCATCAACGTCCGAACCTCCGTGCACTCTGTGGTAGTCGGCCAC
TCT
GTGGAGTTTGAGTGCTTGGCCCTGGGTGACCCTAAGCCTCAGGTGACATGGAGCAAAGTCGGGGGAC
AC
CTACGGCCTGGCATCGTGCAAAGCGGAAGCATCATCAGGATTGCCCACGTGGAGCTGGCTGATGCAGG
A
CAGTACCGCTGTGCAGCTACCAACGCTGCGGGCACCACCCAGTCCCACGTGCTGCTGCTAGTACAAGCC
TTG
CCCCAGATCTCAACTCCCCCGGAGATCCGAGTGCCTGCCGGTTCTGCGGCTGTCTTCCCGTGCATGG
CC
TCAGGCTACCCGACGCCTGCCATCACCTGGAGTAAGGTGGACGGTGACCTGCCACCCGACAGTCGCCT
G
GAAAACAATATGCTGATGCTACCATCAGTTCGCCCCGAGGATGCCGGCACCTACGTGTGCACTGCCACC
AAC
CGGCAGGGCAAGGTCAAAGCCTTTGCCTATCTGCAGGTGCCAGAGCGAGTGATACCCTACTTCACCC
AG
ACACCCTACTCCTTCCTGCCACTTCCCACCATCAAAGATGCCTACAGGAAGTTTGAGATCAAGATCAC
C
TTCCGGCCAGACTCTGCGGATGGGATGCTGCTGTACAATGGGCAGAAGCGGAGTCCCACCAACCTAGCC
AAC
AGACAGCCAGATTTCATCTCCTTTGGCCTCGTGGGCGGAAGGCCTGAGTTTCGATTTGATGCAGGCT
CT
GGCATGGCCACTATCCGCCACCCCACACCTCTGGCCCTAGGCCAGTTCCACACCGTGACCCTGTTACG
A
AGCCTCACTCAAGGATCTCTGATTGTGGGCAATTTGGCCCCTGTCAACGGGACCTCCCAGGGCAAGTTC
CAA
GGTTTAGACCTGAACGAGGAGCTGTATCTGGGTGGCTACCCTGACTACGGTGCCATCCCCAAGGCTG
GG
CTGAGTAGCGGCTTTGTAGGCTGTGTACGTGAGCTGCGTATCCAAGGCGAGGAGGTTGTCTTCCATGA
C
GTCAACCTCACAACACATGGCATCTCCCACTGCCCTACTTGCCAGGACCGACCCTGCCAGAATGGGGGC
CAG
TGCCAAGATTCCGAGAGCAGCAGTTACACGTGTGTCTGCCCTGCTGGCTTCACCGGCAGCCGCTGTG
AA
CATTCGCAAGCCCTGCACTGCCACCCCGAGGCCTGTGGGCCGGACGCCACTTGTGTGAACCGGCCAGA
C
GGTCGAGGCTACACCTGTCGCTGCCACCTGGGCCGCTCCGGGGTGAGGTGTGAAGAAGGTGTAACGGTG
ACC
ACCCCATCGATGTCTGGTGCTGGTTCCTACCTGGCACTACCGGCTCTCACCAACATGCACCATGAGC
TA
CGCCTGGATGTGGAGTTCAAGCCGCTGGAACCCAATGGGATCTTACTGTTCAGTGGGGGCAAGAGCGG
G
CCTGTGGAAGACTTTGTGTCCCTAGCAATGGTTGGTGGCCACCTGGAGTTCCGCTATGAGTTAGGGTCA
G
GT
CTGGCTGTTCTGCGGAGCCACGAGCCACTGACCTTAGGACGCTGGCACCGAGTGTCTGCGGAACGCC
TG
AACAAAGATGGCAGCCTGCGGGTGGATGGAGGGCGTCCTGTGTTACGCTCTTCACCAGGAAAGAGCCA
G
GGCCTTAACCTGCATACCCTGCTCTACCTGGGTGGTGTGGAGCCCTCGGTACAGCTGTCCCCAGCCACC
AAT
ATGAGTGCTCACTTCCATGGCTGTGTGGGTGAGGTATCTGTGAATGGCAAGCGGTTGGACCTCACCT
AC
AGCTTCTTGGGCAGCCAGGGTGTGGGCCAGTGCTATGACAGCTCCCCGTGCGAGCGCCAGCCCTGCCA
G
AATGGCGCCACATGCATGCCTGCGGGCGAATATGAGTTCCAGTGCCTCTGTCAAGATGGCTTCAAAGGA
GAC
CTTTGTGAACATGAGGAGAACCCGTGCCAGCTGCATGAACCATGTCTGAATGGTGGCACCTGCCGGG
GT
GCCCGATGCCTCTGTCTGCCTGGCTTCTCTGGTCCACGCTGCCAACAAGGCGCTGGATATGGGGTAGT
G
GAGTCAGACTGGCACCCTGAAGGCAGTGGAGGCAATGATGCCCCTGGGCAATACGGAGCCTACTTTTAT
GAC
AATGGCTTCCTAGGCCTCCCTGGTAACAGTTTCTCAAGGAGCCTGCCTGAAGTACCCGAGACAATTG
AA
TTCGAGGTTCGGACCAGCACAGCCGATGGCCTCCTGCTCTGGCAGGGTGTGGTGAGAGAGGCCAGCCG
C
AGCAAGGACTTCATTAGCCTTGGACTACAGGATGGCCATCTAGTGTTCAGCTACCAACTGGGCAGTGGG
GAG
GCCCGTCTTGTCTCAGAAGATCCCATCAATGACGGCGAGTGGCATCGGATAACAGCGCTGCGAGAGG
GC
CAGAGAGGCTCCATCCAAGTAGACGGTGAGGATCTGGTCACCGGCCGGTCCCCAGGTCCTAATGTGGC
G
GTCAACACCAAGGACATCATCTACATTGGTGGTGCCCCAGATGTGGCCACACTGACCAGGGGCAAGTTC
TCT
TCTGGGATCACAGGCTGTATCAAGAATCTGGTGTTGCACACGGCCCGGCCTGGAGCCCCACCTCCAC
AG
CCCCTGGACCTGCAGCATCGCGCCCAGGCAGGGGCCAACACACGGCCCTGCCCCTCATAG


Translation (4383 aa):
MGQRAVGSLLLGLLLHARLLAVTHGLRAYDGLSLPEDTETVTASRYGWTYSYLSDDEDLLADDASGDGLG
S
GDVGSGDFQM
VYFRALVNFTRSIEYSPQLEDASAKEFREVSEAVVEKLEPEYRKIPGDQIVSVVFIKEL
D
GWVFVELDVGSEGNADGSQIQEVLHTVVSSGSIGPYVTSPWGFKFRRLGT
VPQFPRVCTETEFACHSYN
E
CVALEYRCDRRPDCRDMSDELNC
EEPVPELSSSTPAVGKVSPLPLWPEAATTPPPPVTHGPQFLLPSVP
G
PSACGPQEASCHSGHCIPRDYLCDGQEDCRDGSDELGC
ASPPPCEPNEFACENGHCALKLWRCDGDFDC
E
DRTDEANC
SVKQPGEVCGPTHFQCVSTNRCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQQSIQASR
G
QTVTFTCVATGVPTPIINWRLNWGHIPAHP
RVTMTSEGGRGTLIIRDVKEADQGAYTCEAMNSRGMVFG
I
PDGVLELVPQR
GPCPDGHFYLEDSASCLPCFCFGVTNVCQSSLRFRDQIRLSFDQPNDFKGVNVTMPSQ
P
GVPPLSSTQLQIDPALQEFQLVDLSRRFLVHDAFWALPKQFLGNK
VDSYGGFLRYKVRYELARGMLEPV
Q
KPDVILVGAGYRLHSRGHTPTHPGTLNQRQVQLSE
EHWVHESGRPVQRAEMLQALASLEAVLLQTVYNT
K
MASVGLSDIVMDTTVTHTTIHGRAHSVEEC
RCPIGYSGLSCESCDAHFTRVPGGPYLGTCSGCNCNGHA
S
SCDPVYGHCL
NCQHNTEGPQCDKCKPGFFGDATKATATACRPCPCPYIDASRRFSDTCFLDTDGQATCD
A
CAPGYTGRRCE
SCAPGYEGNPIQPGGKCRPTTQEIVRCDERGSLGTSGETCRCKNNVVGRLCNECSDGS
F
HLSKQNPDGCLKCFCMGVSRQCSSSSWSRAQ
VLGASEQPSQFSLSNAAGTHTTSEGVSSPAPGELSFSS
F
HNLLSEPYFWSLPASFRGDK
VTSYGGELRFTVTQRPRPSSAPLHRQPLVVLQGNNIVLEHHASRDPSPG
Q
PSNFIVPFQE
QAWQRPDGQPATREHLLMALAGIDALLIQASYTQQPAESRVSGISMDVAVPENTGQDSA
R
EVEQCTCPPGYRGPSCQ
DCDTGYTRVPSGLYLGTCERCNCHGHSETCEPETGACQSCQHHTEGASCEQC
Q
PGYYGDAQRGTPQDCQPCPCYGAPAAG
QAAHTCFLDTDGHPTCDSCSPGHSGRHCERCAPGYYGNPSQG
Q
PCH
RDGQVPEVLGCGCDPHGSISSQCDAAGQCQCKAQVEGRTCSHCRPHHFHLSASNPEGCLPCFCMGV
T
QQCASSSYSRQL
ISTHFAPGDFQGFALVNPQRNSQLTGGFTVEPVHDGARLSFSNFAHLGQESFYWQLP
E
IYQGDK
VAAYGGKLRYTLSYTAGPQGSPLLDPDIQITGNNIMLVASQPALQGPERRSYEIIFREEFWRR
P
DGQPATREHLLMALADLDELLVRATFSSVPRAASISAVSLEVAQPGPSSGPRALEVEECRCPPGYVGLS
C
Q
DCAPGYTRTGSGLYLGQCELCECNGHSDLCHPETGACSRCQHNTAGEFCELCATGYYGDATAGTPEDC
Q
PCACPLTNPEN
MFSRTCESLGAGGYRCTACEPGYTGQYCEQCAPGYEGDPNVQGGRCQPLTKESLEVQI
H
PSRSVVPQGGPHSLRCQVSGSPPHYFYWSREDGRPLPSSAQQRHQ
GSELHFPSVQPSDAGVYICTCRNL
I
HTSNSRAELLVA
EAPSKPITVTVEEQRSQSVRPGADVTFICTAKSKSPAYTLVWTRLHNGKLPSRAMDF
N
GILTIRNVQPSDAGTYVCTGSNMFAMDQGTATLHVQ
VSGTSTAPVASIHPPQLTVQPGQQAEFRCSATG
N
PTPMLEWI
GGPSGQLPAKAQIHNGILRLPAIEPSDQGQYLCRALSSAGQHVARAMLQVHGGSGPRVQVS
P
ERTQVHEGRTVRLYCRAAGVPSASITWRKEGGSLPPQ
ARSENTDIPTLLIPAITAADAGFYLCVATSPT
G
TAQARIQVVVLS
ASGANSVPVRIESSSPSVTEGQTLDLNCAVMGLTYTQVTWYKRGGSLPPHAQVHGSR
L
RLPQVSPADSGDYVCRVESDVGPKEASIVVSVLHSPHSGPSYTP
ATSITPPIRIESSSSHVAEGQTLDL
N
CVVPGQAQVTWRKRGGSLPARHQ
THGSLLRLHQVSPADSGEYVCHVVLGSEHTETSVLVTIEPAESIPA
P
GPAPPVRIEASSSTVTEGHMLDLNCVVAGQAHAQVTWYKRGGSLPARHQ
VRGSRLYILQASPADAGEYV
C
RAGNGQEATITVTVTRNHGANLAY
PPGSTSPIRIESSSSHVAEGQTLDLNCVVQGQAHAQVTWHKRGGS
L
PARHQ
THGSLLRLHQVSPVDSGEYVCRVEGGAVPLESSVLVTIEPAGTAPGVIPPVRIESSSSHVSEGQ
S
LDLNCLVSGQTHPQISWHKRGGSLPARHQ
VHGSRLRLLQVTPTDSGEYVCRVVSGSGTQEASILVTIQQ
T
LSPSH
SQSVVHPVRIESSSPSLANGHTLDLNCLVASLTPHTITWYKRGGSLPSRHQIVGSRLRIPQVTP
A
DSGEYVCHVSNGAGSQETSLIVTIESRGPSH
VPSVSPPMRIETSSPTVTEGQTLDLNCVVVGRPQATIT
W
YKRGGSLPFRHQ
AHGSRLRLHHMSVADSGEYVCRANNNIDAQETSIMISVSPSTNSPPAPASPAPIRIE
S
SSSRVAEGQTLDLNCVVPGHAHAQVTWHKRGGSLPTHHQ
THGSRLRLYQVSSADSGEYVCSVLSSSGPL
E
ASVLVSITPAAANVHIPGEVP
FPPIRIETSSSRVAEGQTLDLSCVVPGQAHAQVTWHKRGGSLPAGHQV
H
GHMLRLNRVSPADSGEYSCQVTGSSGTLEASVLVTI