NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS50497.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
50497.1 Public Mus musculus 2 Atp5c1 23 108 98 CCDS HistoryNCBI Gene:11949Re-query CCDS DB by CCDS ID:50497.1Re-query CCDS DB by GeneID:11949See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 50497.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000114896.7 ENSMUSP00000110546.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000114896.7Link to Ensembl Protein Viewer:ENSMUSP00000110546.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000114896Re-query CCDS DB by Protein ID:ENSMUSP00000110546
Original member Current member NCBI NM_001112738.1 NP_001106209.1 Accepted alive Link to Nucleotide Sequence:NM_001112738.1Link to Protein Sequence:NP_001106209.1Re-query CCDS DB by Nucleotide ID:NM_001112738Re-query CCDS DB by Protein ID:NP_001106209Link to BLAST:NP_001106209.1

Chromosomal Locations for CCDS 50497.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 10056800 10056806 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 10058996 10059092 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 10059501 10059656 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 10063286 10063350 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 10063443 10063586 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 10064107 10064311 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 10068610 10068741 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 10069693 10069711 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (825 nt):
ATGGCAACTCTGAAAGATATTACCAGGAGACTGAAGTCCATCAAAAACATCCAGAAAATTACCAAGTCTA
TG
AAGATGGTGGCAGCTGCAAAGTATGCCCGGGCTGAGCGGGAGCTGAAGCCTGCCCGAGTGTATGGGAC
A
GGTTCTTTGGCTCTGTATGAGAAGGCTGATATTAAGGCACCTGAGGACAAGAAGAAGCACCTCATTATT
GGT
GTGTCCTCAGATAGAGGGCTTTGTGGTGCTATTCACTCCTCAGTGGCTAAACAGATGAAGAATGAAG
TG
GCTGCCCTCACAGCAGCTGGGAAAGAAGTTATGATTGTTGGAGTTGGTGAAAAAATCAAGGGCATACT
T
TATAGGACTCATTCTGATCAGTTTTTGGTGTCATTCAAAGATGTGGGACGGAAGCCTCCTACTTTTGGA
GAT
GCATCAGTCATTGCCCTTGAGTTGTTAAATTCTGGATATGAATTTGATGAAGGCTCTATCATTTTTA
AT
CAGTTCAAGTCTGTTATCTCCTACAAGACAGAAGAGAAGCCCATCTTCTCTCTGAATACCATTGCGAC
T
GCTGAGACCATGAGCATCTATGATGACATTGATGCTGATGTGCTGCAGAATTACCAGGAGTACAATCTG
GCC
AACCTCATCTACTACTCCCTGAAGGAGTCCACCACCAGTGAGCAGAGTGCCAGGATGACCGCCATGG
AC
AACGCCAGCAAGAACGCTTCTGATATGATTGACAAATTGACCTTGACTTTCAACCGCACCCGCCAGGC
T
GTCATCACAAAGGAGTTGATTGAAATCATCTCTGGGGCTGCTGCTCTGGATTAA


Translation (274 aa):
MATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVYGTGSLALYEKADIKAPEDKKKHLII
G
VSSDRGLCGAIHSSVAKQMKNEVAALTAAGKEVMIVGVGEKIKGILY
RTHSDQFLVSFKDVGRKPPTFG
D
ASVIALELLNSGYEFDEGSIIFNQF
KSVISYKTEEKPIFSLNTIATAETMSIYDDIDADVLQNYQEYNL
A
NLIYYSLKESTTSEQSARMTAMDNASKNA
SDMIDKLTLTFNRTRQAVITKELIEIISGAAALD



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser