NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS50442.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
50442.1 Public Mus musculus 19 Cnnm1 21 106 86 CCDS HistoryNCBI Gene:83674Re-query CCDS DB by CCDS ID:50442.1Re-query CCDS DB by GeneID:83674See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 50442.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000165311 ENSMUSP00000131830 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000165311Link to Ensembl Protein Viewer:ENSMUSP00000131830Re-query CCDS DB by Nucleotide ID:ENSMUST00000165311Re-query CCDS DB by Protein ID:ENSMUSP00000131830
Original member NCBI NM_031396.2 NP_113573.2 Updated not alive Link to Nucleotide Sequence:NM_031396.2Link to Protein Sequence:NP_113573.2Re-query CCDS DB by Nucleotide ID:NM_031396Re-query CCDS DB by Protein ID:NP_113573
Current member NCBI NM_031396.3 NP_113573.2 Accepted alive Link to Nucleotide Sequence:NM_031396.3Link to Protein Sequence:NP_113573.2Re-query CCDS DB by Nucleotide ID:NM_031396Re-query CCDS DB by Protein ID:NP_113573Link to BLAST:NP_113573.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_113573.2 951 Q0GA42 951 100% 0 0

Chromosomal Locations for CCDS 50442.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 43440445 43442017 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 43465121 43465264 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 43468241 43468381 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 43469609 43469778 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 43471849 43471948 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 43472377 43472424 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 43484845 43485008 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 43491421 43491604 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 43491764 43491913 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 43493710 43493811 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 43494959 43495038 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2856 nt):
ATGGCGGCGGCGGCCGCGGCGGCAGCAGCGCTGGGTGTCAGGCTCCGGGACTGCTGCAGCCGGGGCGCCG
TA
CTCCTGCTCTTCTTCTCCCTGTCCCCTCGGCCCCCGGCCGCCGCTGCCTGGTTACTGGGTCTGCGACC
C
GAAGACACTGCCGGAGGCCGCGTGTCTCTGGAGGGGGGCACCCTGCGGGCGGCCGAAGGCACCAGCTTC
CTC
CTGCGGGTCTACTTCCAGCCTGGCCCGCCGGTCCCCGCCGCGCCCGTGCCCGCACCCTCCCTGGCCC
CG
GGGGAAAACGGCACGGGCGATTGGGCCCCGCGGCTCGTGTTCATCGAGGAGCCCCCGGGCGCGGGCGG
C
GCGGCGCCCAGCGCGGTCCCCACGCGTCCCCCGGGACCTCAGCGCTGCCGCGAGCAGAGCGACTGGGCG
TCG
GACGTGGAGGTCCTGGGGCCCCTGCGCCCCGGGGGCGTGGCGGGCTCGGCCCTGGTCCAGGTGCGGG
TG
CGGGAGCTGCGGAAGGGCGAGGCGGAGCGCGGCGGCGCGGGCGGCGGCGGGAAGCTCTTTTCGCTGTG
C
GCCTGGGACGGGCGCGCTTGGCACCACCACGGCGCCGCCGGCGGCTTCCTGCTGCGCGTCCGCCCGCGC
CTC
TACGGCCCGGGTGGGGACCTGCTGCCGCCCGCGTGGCTGCGAGCGCTCGGGGCGCTCCTGCTGCTGG
CC
CTGTCCGCCCTGTTCAGCGGCCTGCGCCTGAGCCTGCTCTCGCTGGACCCGGTGGAGTTACGGGTGCT
G
CGGAACAGTGGCTCGGCCGCCGAGCAGGAGCAGGCGCGCCGCGTGCAGGCCGTGCGCGGCAGGGGGACC
CAT
CTGCTCTGCACCCTGCTCCTGGGCCAAGCCGGCGCCAATGCCGCGCTGGCCGGCTGGCTGTACGCCT
CG
CTGCCGCCGGGCGTCGGGGACCCCGGGGAGGACTCCGGCGAGGCGGGGGTTCACTTCCCGTGGCTGCC
G
GCGCTGGTGTGCACCGGCGCCGTGTTCCTGGGAGCCGAGATCTGTCCGTACTCGGTGTGCTCGCGCCAC
GGG
TTGGCCATCGCCTCGCACAGTGTGTGCCTGACCCGGCTCCTCATGGCGGCTGCCTTCCCGGTGTGCT
AC
CCTCTGGGCCGCCTCCTGGACTGGGCTCTGCGCCAGGAGATCAGCACCTTCTACACGAGGGAAAAGCT
G
CTGGAGACGCTGCGGGCCGCCGACCCTTACAGCGACCTGGTGAAGGAAGAGCTCAACATCATTCAGGGA
GCC
CTGGAGCTGCGCACCAAGGTGGTAGAGGAGGTGCTGACCCCTCTAGGGGACTGCTTCATGTTGCGCT
CT
GACGCCGTGCTTGACTTCGCCACTGTATCCGAGATCCTCCGTAGTGGCTACACTCGCATCCCGGTGTA
T
GAGGGCGACCAGAGGCACAACATTGTGGACATTCTGTTCGTCAAAGACTTGGCCTTTGTGGACCCGGAC
GAC
TGTACCCCGCTGCTCACAGTCACCCGCTTCTACAACAGGCCCCTGCATTGTGTCTTCAATGATACCC
GG
CTGGACACTGTACTGGAGGAGTTTAAGAAGGGAAAATCTCACTTGGCCATTGTCCAGAGAGTGAACAA
C
GAGGGTGAAGGAGACCCTTTCTATGAGGTGATGGGCATTGTGACTCTGGAGGACATCATAGAAGAGATC
ATC
AAGTCGGAGATCCTCGACGAAACTGACCTCTACACTGACAATCGGAAAAAGCAGAGGGTCCCACACC
GG
GAGAGAAGGCGGCATGATTTCTCTCTGTTCAAGCTTTCAGACTCCGAGATCAGAGTCAAGATCTCGCC
A
CAGCTGCTGCTTGCCACACACCGCTTCATGGCCACAGAAGTGGAGCCCTTTAAGTCCCTGTACCTTTCG
GAG
AAGATCCTGCTCCGGCTTCTGAAACATCCCAACGTGATCCAGGAGCTTAAGTTTGATGAGAGGAACA
AG
AAAGCCCCAGAACACTACCTCTACCAGCGCAACCGCCCGGTGGACTATTTTGTGCTGCTCTTACAGGG
G
AAAGTGGAAGTGGAGGTTGGTAAGGAAGGCCTTCGCTTTGAGAACGGAGCCTTTACCTACTATGGTGTT
CCA
GCCATCATGACCAGCGCTTGCTCAGATAATGACGTGCGGAAGGTTGGAAGTCTGGCTGGATCCTCTG
TC
TTCCTAAACCGGTCCCCTTCTCGCTGCAGCGGGTTGAATCGCTCCGAGTCTCCAAACCGAGAGCGCAG
T
GACTTCGGCGGAAGCAACACGCAACTGTACAGCAGCAGCAACAACCTCTACACACCTGACTACTCGGTG
CAC
ATTCTCAGTGATGTGCAGTTCGTGAAGATCACACGACAACAGTACCAGAACGCACTCACGGCCTGCC
AC
ATGGACAGCTCACCCCAGTCCCCGGATATGGAAGCCTTCACTGATGGGGACTCCACCAAGGCCCCCAC
C
ACCCGGGGCACACCCCAGACTCCAAAGGACGACCCGGTCCTCACCCTCCTGAGCAACAGGACCAGCTTG
CCA
TGCAGCCGCTCGGATGGTCTGAGAAGCCCAGGCGAGGTTGTGTACCTGAGGATGGAGGAGATGGCCT
TC
CCCCAAGAAGAGATGCCCAACTTTGAGGAGCACAGGTCACAGCAAGTCTCGCTGTCCCCTGTCGCAGT
T
CCTACAACAGCAGCTTCGGATCCTGAATGCTGTAATATCCACCTGGATCCAGAGGCCAGCCCCTGCAGC
AGC
GACTCTGAGGAAAACATGGGCAAGAAGCTGCTGAGAACCTTGAGTGGCCGGAAAAGAAAGAAGTCCG
CA
GACGGGGAGCGAGCCTCCGAGGAAAACTCCAATTTAACGCCCCTGATCACATGA


Translation (951 aa):
MAAAAAAAAALGVRLRDCCSRGAVLLLFFSLSPRPPAAAAWLLGLRPEDTAGGRVSLEGGTLRAAEGTSF
L
LRVYFQPGPPVPAAPVPAPSLAPGENGTGDWAPRLVFIEEPPGAGGAAPSAVPTRPPGPQRCREQSDWA
S
DVEVLGPLRPGGVAGSALVQVRVRELRKGEAERGGAGGGGKLFSLCAWDGRAWHHHGAAGGFLLRVRPR
L
YGPGGDLLPPAWLRALGALLLLALSALFSGLRLSLLSLDPVELRVLRNSGSAAEQEQARRVQAVRGRGT
H
LLCTLLLGQAGANAALAGWLYASLPPGVGDPGEDSGEAGVHFPWLPALVCTGAVFLGAEICPYSVCSRH
G
LAIASHSVCLTRLLMAAAFPVCYPLGRLLDWALRQEISTFYTREKLLETLRAADPYSDLVKEELNIIQG
A
LELRTKVVEEVLTPLGDCFMLRSDAVLDFATVSEILRSGYTRIPVYEGDQRHNIVDILFVKDLAFVDPD
D
CTPLLTVTRFYNRPLHCVFNDTRLDTVLEEFKK
GKSHLAIVQRVNNEGEGDPFYEVMGIVTLEDIIEEI
I
KSEILDETDLY
TDNRKKQRVPHRERRRHDFSLFKLSDSEIRVKISPQLLLATHRFMATEVEPFKSLYLS
E
KILLRLLKHPNVIQELKFDERNKKAPEHYLYQRNRPVDYFVLLLQ
GKVEVEVGKEGLRFENGAFTYYGV
P
AIMTSACS
DNDVRKVGSLAGSSVFLNRSPSRCSGLNRSESPNRERSDFGGSNTQLYSSSNNLYTPDYSV
H
ILSDVQFVK
ITRQQYQNALTACHMDSSPQSPDMEAFTDGDSTKAPTTRGTPQTPKDDPVLTLLSNRTSL
P
CSRSDGLRSPGEVVYLRMEEMAFPQEEMPNFEEHRSQQVSLSPVAVPTTAASDPECCNIHLDPEASPCS
S
DSEENMGKKLLRTL
SGRKRKKSADGERASEENSNLTPLIT



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser